Clone BO28103 Report

Search the DGRC for BO28103

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptCp15-RA
Protein status:BO28103.pep: Imported from assembly
Sequenced Size:379

Clone Sequence Records

BO28103.complete Sequence

379 bp assembled on 2011-06-17

GenBank Submission: KX795877

> BO28103.complete
GAAGTTATCAGTCGACATGAAGTACCTGATTGTCTGCGTTACCCTGGCCC
TTTTCGCCTACATCAACGCCAGCCCAGCGTACGGCAACCGTGGAGGTTAT
GGTGGTGGCTACGGTGGTGGCTACGGTCCTGTTCAGCGCGTCGTCTACGA
GGAGGTGCCCGCCTACGGACCATCCCGTGGCTACAACAGCTATCCCCGCA
GCCTGCGATCGGAGGGTAATGGAGGAAGTGCCGCTGCCGCTGCCGCCGCT
TCCGCCGCTGCCGTGAATCCCGGAACCTACAAGCAGTACGCCATTCCCTC
CTACGAGTTGGATGGCGCTCGCGGCTACGAGATCGGACACGGCTACGGCC
AACGTGCTTACGCAAGCTTTCTAGACCAT

BO28103.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Cp15-RA 348 CG6519-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Cp15-RA 515 CG6519-RA 46..391 16..361 1730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8728609..8728942 28..361 1670 100 Plus
Blast to na_te.dros performed 2014-11-26 14:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 413..462 196..245 115 70 Plus

BO28103.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:45 Download gff for BO28103.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 47..391 17..363 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:44:31 Download gff for BO28103.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 47..391 17..363 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:50 Download gff for BO28103.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 47..391 17..363 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:50 Download gff for BO28103.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8728609..8728942 28..363 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:31 Download gff for BO28103.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8721709..8722042 28..363 99   Plus

BO28103.pep Sequence

Translation from 16 to 379

> BO28103.pep
MKYLIVCVTLALFAYINASPAYGNRGGYGGGYGGGYGPVQRVVYEEVPAY
GPSRGYNSYPRSLRSEGNGGSAAAAAAASAAAVNPGTYKQYAIPSYELDG
ARGYEIGHGYGQRAYASFLDH

BO28103.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cp15-PA 115 CG6519-PA 1..115 1..115 614 100 Plus