Clone BO28104 Report

Search the DGRC for BO28104

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG10320-RA
Protein status:BO28104.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO28104.complete Sequence

364 bp assembled on 2011-06-17

GenBank Submission: KX797001

> BO28104.complete
GAAGTTATCAGTCGACATGGGCGGACATCACGGCGAACCCTACACGGTGC
CCCACGCATCGACCTACAAGGTGGAGAGTGTGCCCCAACTCGTGGAGGTG
AAGGAGGCTCTGGGCCGCCAGGGATTGAAGGATCCATGGCTGAGGAACGA
AGTCTGGCGCTATGAGCCCAAGGCCTTCGGCACCCACAGATCCCGCCTGA
ACACCTTCCTTTTCCGCGGACTCGGCGTGGGATTCTGCGCTTTCCTGGCC
ACCGTCGCCGTGGAGTACGCGCTGGGCATTGGCAAGGGTCAGGGCGGCCA
TGGACATGGCCACGGTCACGAGGAACACGGAGATAAGGGCCACCATGCAA
GCTTTCTAGACCAT

BO28104.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-RE 333 CG10320-PE 1..330 17..346 1650 100 Plus
CG10320-RD 333 CG10320-PD 1..330 17..346 1650 100 Plus
CG10320-RC 333 CG10320-PC 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-RE 405 CG10320-RE 40..369 17..346 1650 100 Plus
CG10320-RD 525 CG10320-RD 160..489 17..346 1650 100 Plus
CG10320-RC 520 CG10320-RC 155..484 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21658538..21658741 143..346 1020 100 Plus
2R 25286936 2R 21658353..21658481 17..145 645 100 Plus
Blast to na_te.dros performed 2014-11-26 14:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 354..395 80..121 102 71.4 Plus

BO28104.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:45 Download gff for BO28104.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RE 43..372 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:44:37 Download gff for BO28104.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 155..484 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:56 Download gff for BO28104.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 155..484 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:56 Download gff for BO28104.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658353..21658480 17..144 100 -> Plus
2R 21658540..21658741 145..348 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:37 Download gff for BO28104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17545858..17545985 17..144 100 -> Plus
arm_2R 17546045..17546246 145..348 99   Plus

BO28104.pep Sequence

Translation from 16 to 364

> BO28104.pep
MGGHHGEPYTVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYE
PKAFGTHRSRLNTFLFRGLGVGFCAFLATVAVEYALGIGKGQGGHGHGHG
HEEHGDKGHHASFLDH

BO28104.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-PE 110 CG10320-PE 1..110 1..110 616 100 Plus
CG10320-PD 110 CG10320-PD 1..110 1..110 616 100 Plus
CG10320-PC 110 CG10320-PC 1..110 1..110 616 100 Plus
CG10320-PB 110 CG10320-PB 1..110 1..110 616 100 Plus
CG10320-PA 110 CG10320-PA 1..110 1..110 616 100 Plus