Clone BO28108 Report

Search the DGRC for BO28108

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptRpL37a-RA
Protein status:BO28108.pep: Imported from assembly
Sequenced Size:313

Clone Sequence Records

BO28108.complete Sequence

313 bp assembled on 2011-06-17

GenBank Submission: KX793826

> BO28108.complete
GAAGTTATCAGTCGACATGACGAAGGGTACCTCCAGCTTTGGTAAGCGCC
ACAATAAGACGCACACCCTGTGCCGTCGCTGTGGCCGCTCCTCCTACCAC
ATCCAGAAGTCCACTTGCGCCCAGTGCGGCTACCCCGCCGCCAAGTTGCG
TTCCTACAACTGGTCCGTGAAGGCCAAGAGGAGGAAGACCACCGGCACCG
GTCGCATGCAGCACCTGAAGGTTGTGCGCCGCCGTTTCCGCAACGGATTC
CGCGAGGGCACCCAGGCCAAGCCCAAGAAGGCCGTGGCCAGCAAGGCAAG
CTTTCTAGACCAT

BO28108.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37a-RB 282 CG9091-PB 1..279 17..295 1395 100 Plus
RpL37a-RA 282 CG9091-PA 1..279 17..295 1395 100 Plus
RpL37b-RA 270 CG9873-PA 1..233 17..249 265 74.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37a-RB 565 CG9091-RB 114..392 17..295 1395 100 Plus
RpL37a-RA 1296 CG9091-RA 114..392 17..295 1395 100 Plus
RpL37b-RA 422 CG9873-RA 106..338 17..249 265 74.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15138774..15138913 295..156 700 100 Minus
X 23542271 X 15138979..15139115 155..19 685 100 Minus
2R 25286936 2R 23100141..23100373 249..17 265 74.2 Minus
Blast to na_te.dros performed on 2014-11-26 14:52:57 has no hits.

BO28108.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:46 Download gff for BO28108.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 137..415 17..297 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:44:43 Download gff for BO28108.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 114..392 17..297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:01 Download gff for BO28108.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 114..392 17..297 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:01 Download gff for BO28108.complete
Subject Subject Range Query Range Percent Splice Strand
X 15138772..15138913 156..297 98 <- Minus
X 15138979..15139116 17..155 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:43 Download gff for BO28108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15032805..15032946 156..297 98 <- Minus
arm_X 15033012..15033149 17..155 99   Minus

BO28108.pep Sequence

Translation from 16 to 313

> BO28108.pep
MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWS
VKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASKASFLDH

BO28108.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37a-PB 93 CG9091-PB 1..93 1..93 500 100 Plus
RpL37a-PA 93 CG9091-PA 1..93 1..93 500 100 Plus
RpL37b-PA 89 CG9873-PA 1..87 1..87 372 77 Plus