BO28108.complete Sequence
313 bp assembled on 2011-06-17
GenBank Submission: KX793826
> BO28108.complete
GAAGTTATCAGTCGACATGACGAAGGGTACCTCCAGCTTTGGTAAGCGCC
ACAATAAGACGCACACCCTGTGCCGTCGCTGTGGCCGCTCCTCCTACCAC
ATCCAGAAGTCCACTTGCGCCCAGTGCGGCTACCCCGCCGCCAAGTTGCG
TTCCTACAACTGGTCCGTGAAGGCCAAGAGGAGGAAGACCACCGGCACCG
GTCGCATGCAGCACCTGAAGGTTGTGCGCCGCCGTTTCCGCAACGGATTC
CGCGAGGGCACCCAGGCCAAGCCCAAGAAGGCCGTGGCCAGCAAGGCAAG
CTTTCTAGACCAT
BO28108.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:52:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL37a-RB | 282 | CG9091-PB | 1..279 | 17..295 | 1395 | 100 | Plus |
RpL37a-RA | 282 | CG9091-PA | 1..279 | 17..295 | 1395 | 100 | Plus |
RpL37b-RA | 270 | CG9873-PA | 1..233 | 17..249 | 265 | 74.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:53:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL37a-RB | 565 | CG9091-RB | 114..392 | 17..295 | 1395 | 100 | Plus |
RpL37a-RA | 1296 | CG9091-RA | 114..392 | 17..295 | 1395 | 100 | Plus |
RpL37b-RA | 422 | CG9873-RA | 106..338 | 17..249 | 265 | 74.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:52:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 15138774..15138913 | 295..156 | 700 | 100 | Minus |
X | 23542271 | X | 15138979..15139115 | 155..19 | 685 | 100 | Minus |
2R | 25286936 | 2R | 23100141..23100373 | 249..17 | 265 | 74.2 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:52:57 has no hits.
BO28108.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:46 Download gff for
BO28108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL37a-RA | 137..415 | 17..297 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:44:43 Download gff for
BO28108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL37a-RA | 114..392 | 17..297 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:01 Download gff for
BO28108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL37a-RA | 114..392 | 17..297 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:01 Download gff for
BO28108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 15138772..15138913 | 156..297 | 98 | <- | Minus |
X | 15138979..15139116 | 17..155 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:43 Download gff for
BO28108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 15032805..15032946 | 156..297 | 98 | <- | Minus |
arm_X | 15033012..15033149 | 17..155 | 99 | | Minus |
BO28108.pep Sequence
Translation from 16 to 313
> BO28108.pep
MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWS
VKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASKASFLDH
BO28108.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL37a-PB | 93 | CG9091-PB | 1..93 | 1..93 | 500 | 100 | Plus |
RpL37a-PA | 93 | CG9091-PA | 1..93 | 1..93 | 500 | 100 | Plus |
RpL37b-PA | 89 | CG9873-PA | 1..87 | 1..87 | 372 | 77 | Plus |