Clone BO28109 Report

Search the DGRC for BO28109

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG15418-RA
Protein status:BO28109.pep: Imported from assembly
Sequenced Size:325

Clone Sequence Records

BO28109.complete Sequence

325 bp assembled on 2011-09-14

GenBank Submission: KX798161

> BO28109.complete
GAAGTTATCAGTCGACATGGTTTGGATTTCGAGCTGGGGGCAACTTTGGC
TGGTGTTGCTATTGGTTGTGGGCCTATCGTTGGGTCTTCCGAGCTTGGAA
AACCAGACACACGAACAAATCGAACAGATAATAGCCTGCAGACAGCCAAA
GGCACCTGGTTTGTGCCGGGGTCACCAGTTGCGATATGCCTACAACAAGA
AGACCGGAAACTGCGAGAGCTTCATCTACACGGGCTGTGCCTCCACTGAG
AACAATTTCCTGACCTTCGAGGAGTGTCGCAGGGATTGCATGCAACGTCT
GCGCTACGCAAGCTTTCTAGACCAT

BO28109.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15418-RA 294 CG15418-PA 1..291 17..307 1455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15418-RA 508 CG15418-RA 176..466 17..307 1455 100 Plus
Dot-RB 2303 CG2788-RB 1882..2056 307..133 875 100 Minus
Dot-RB 2303 CG2788-RB 2119..2236 134..17 590 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3621152..3621326 307..133 875 100 Minus
2L 23513712 2L 3621389..3621506 134..17 590 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:11:56 has no hits.

BO28109.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:06 Download gff for BO28109.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 176..466 17..309 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:08:27 Download gff for BO28109.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 176..466 17..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:05:32 Download gff for BO28109.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 176..466 17..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:05:32 Download gff for BO28109.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3621149..3621324 135..309 98 <- Minus
2L 3621389..3621506 17..134 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:08:27 Download gff for BO28109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3621149..3621324 135..309 98 <- Minus
arm_2L 3621389..3621506 17..134 100   Minus

BO28109.pep Sequence

Translation from 16 to 325

> BO28109.pep
MVWISSWGQLWLVLLLVVGLSLGLPSLENQTHEQIEQIIACRQPKAPGLC
RGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRLRYASF
LDH

BO28109.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15418-PA 97 CG15418-PA 1..97 1..97 531 100 Plus
CG3604-PB 132 CG3604-PB 55..113 41..99 145 44.1 Plus
CG3604-PA 132 CG3604-PA 55..113 41..99 145 44.1 Plus
CG2816-PB 84 CG2816-PB 9..81 16..91 134 38.2 Plus