Clone BO28114 Report

Search the DGRC for BO28114

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG15423-RA
Protein status:BO28114.pep: Imported from assembly
Sequenced Size:355

Clone Sequence Records

BO28114.complete Sequence

355 bp assembled on 2011-06-17

GenBank Submission: KX794449

> BO28114.complete
GAAGTTATCAGTCGACATGCCGTACTACGAGGAGGAACGTCGTCATCACC
ATCATCACCATCACGGTGGAAGGCCAATTGTAGAGGTGGACATTGTGCCG
CCAAGGATTCCTCGACCAGTGATTGAGATCGGAGTGGGCGGCCGGTATCC
ACCACCACCGCCCAGGGTGGAGGTCATCACACCAGCTGCCGTCTACCAGC
CGCCACCACCACGACCCATTATCGAGGTGGATGTGGTGCCACCAAGAGCT
CCCTTCATCGAGTTCAACATCGGCGGTCGGCGTCCACCTCCCAGGGAAGA
GGTCATCATCGTTCAGCAACCCCCACCGCCCAGGTGGGCAAGCTTTCTAG
ACCAT

BO28114.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-RA 324 CG15423-PA 1..321 17..337 1590 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-RA 566 CG15423-RA 73..393 17..337 1590 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4006113..4006433 17..337 1590 99.7 Plus
Blast to na_te.dros performed on 2014-11-26 14:53:41 has no hits.

BO28114.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:48 Download gff for BO28114.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 73..393 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:00 Download gff for BO28114.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 73..393 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:20 Download gff for BO28114.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 73..393 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:20 Download gff for BO28114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4006113..4006433 17..339 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:00 Download gff for BO28114.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4006113..4006433 17..339 99   Plus

BO28114.pep Sequence

Translation from 16 to 355

> BO28114.pep
MPYYEEERRHHHHHHHGGRPIVEVDIVPPRIPRPVIEIGVGGRYPPPPPR
VEVITPAAVYQPPPPRPIIEVDVVPPRAPFIEFNIGGRRPPPREEVIIVQ
QPPPPRWASFLDH

BO28114.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-PA 107 CG15423-PA 1..107 1..107 608 100 Plus