BO28125.complete Sequence
205 bp assembled on 2011-06-17
GenBank Submission: KX796896
> BO28125.complete
GAAGTTATCAGTCGACATGAAATACTTTGTGGTCCTTGTCGTCCTGGCCC
TCATTTTGGCCATCAGCGTGGGTCCTTCGGATGCAGTATTTATTGATATT
CTTGACAAAGTGGAAAACGCAATACACAATGCTGCTCAAGTGGGAATTGG
CTTTGCTAAGCCCTTTGAAAAATTGATCAATCCGAAGGCAAGCTTTCTAG
ACCAT
BO28125.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:55:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Anp-RB | 174 | CG1361-PB | 1..171 | 17..187 | 855 | 100 | Plus |
| Anp-RA | 174 | CG1361-PA | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:55:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Anp-RB | 373 | CG1361-RB | 38..208 | 17..187 | 855 | 100 | Plus |
| Anp-RA | 272 | CG1361-RA | 38..208 | 17..187 | 855 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:55:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 30209985..30210081 | 17..113 | 485 | 100 | Plus |
| 3R | 32079331 | 3R | 30210142..30210217 | 112..187 | 380 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:55:03 has no hits.
BO28125.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:53 Download gff for
BO28125.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Anp-RA | 38..208 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:29 Download gff for
BO28125.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Anp-RA | 38..208 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:45 Download gff for
BO28125.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Anp-RA | 38..208 | 17..189 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:45 Download gff for
BO28125.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 30209985..30210080 | 17..112 | 100 | -> | Plus |
| 3R | 30210143..30210217 | 113..189 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:29 Download gff for
BO28125.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 26035707..26035802 | 17..112 | 100 | -> | Plus |
| arm_3R | 26035865..26035939 | 113..189 | 97 | | Plus |
BO28125.pep Sequence
Translation from 16 to 205
> BO28125.pep
MKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHNAAQVGIGFAKPF
EKLINPKASFLDH
BO28125.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:30:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Anp-PB | 57 | CG1361-PB | 1..57 | 1..57 | 279 | 100 | Plus |
| Anp-PA | 57 | CG1361-PA | 1..57 | 1..57 | 279 | 100 | Plus |
