Clone BO28148 Report

Search the DGRC for BO28148

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptVm26Ab-RA
Protein status:BO28148.pep: Inserted from web
Sequenced Size:538

Clone Sequence Records

BO28148.complete Sequence

538 bp assembled on 2011-06-17

GenBank Submission: KX796496

> BO28148.complete
GAAGTTATCAGTCGACATGGCATTCAACTTTGGTCACCTCCTCATCGCCG
GCCTCGTGGCCTTGTCCGCCGTGTCCTCGGAGACCATCCAGCTGCAGCCC
ACTCAGGGCATCCTCATCCCCGCCCCGCTGGCCGAGAACATCCGTGTGTC
GCGTGCCGCCTACGGAGGATACGGCGCTGCCCCAGCCGCCCCATCGTACT
CCGCCCCAGCCGCTCCCGCTGCCCAGGCCTACTCTGCTCCCGCTGCCCCA
GCCTACTCCGCACCCGCTGCTCCCGCCTACTCCGCACCCGCTGCTCCTGC
CTACTCTGCTCCCGCTGCCCCAGCTTACTCTGCCCCAGCCGCACCAGCTT
ACTCCGCACCCGCCTCCATTCCGTCGCCGCCGTGCCCCAAGAACTACCTG
TTCAGCTGCCAGCCCTCCCTGCAGCCCGTGCCCTGCTCCGCCCCAGCTCA
GTCCTACGGATCCGCCGGTGCCTACTCCCAGTACGTGCCCCAGTACGCCG
TGCCCTTCGTCCGCGAACTTGCAAGCTTTCTAGACCAT

BO28148.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Ab-RB 507 CG9046-PB 1..504 17..520 2520 100 Plus
Vm26Ab-RA 507 CG9046-PA 1..504 17..520 2520 100 Plus
Vm26Ab-RB 507 CG9046-PB 196..324 236..364 360 85.3 Plus
Vm26Ab-RB 507 CG9046-PB 220..348 212..340 360 85.3 Plus
Vm26Ab-RA 507 CG9046-PA 196..324 236..364 360 85.3 Plus
Vm26Ab-RA 507 CG9046-PA 220..348 212..340 360 85.3 Plus
Vm34Ca-RA 360 CG9271-PA 194..325 354..485 300 81.8 Plus
Vm26Ab-RB 507 CG9046-PB 194..275 282..363 230 85.4 Plus
Vm26Ab-RB 507 CG9046-PB 266..347 210..291 230 85.4 Plus
Vm26Ab-RA 507 CG9046-PA 266..347 210..291 230 85.4 Plus
Vm26Ab-RA 507 CG9046-PA 194..275 282..363 230 85.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Ab-RB 636 CG9046-RB 63..566 17..520 2520 100 Plus
Vm26Ab-RA 625 CG9046-RA 63..566 17..520 2520 100 Plus
Vm26Ab-RB 636 CG9046-RB 258..386 236..364 360 85.3 Plus
Vm26Ab-RB 636 CG9046-RB 282..410 212..340 360 85.3 Plus
Vm26Ab-RA 625 CG9046-RA 258..386 236..364 360 85.3 Plus
Vm26Ab-RA 625 CG9046-RA 282..410 212..340 360 85.3 Plus
Vm34Ca-RA 491 CG9271-RA 240..371 354..485 300 81.8 Plus
Vm26Ab-RB 636 CG9046-RB 256..337 282..363 230 85.4 Plus
Vm26Ab-RB 636 CG9046-RB 328..409 210..291 230 85.4 Plus
Vm26Ab-RA 625 CG9046-RA 256..337 282..363 230 85.4 Plus
Vm26Ab-RA 625 CG9046-RA 328..409 210..291 230 85.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5957066..5957569 17..520 2520 100 Plus
2L 23513712 2L 5957261..5957389 236..364 360 85.3 Plus
2L 23513712 2L 5957285..5957413 212..340 360 85.3 Plus
2L 23513712 2L 13411261..13411392 485..354 300 81.8 Minus
2L 23513712 2L 5959936..5960031 478..383 255 84.4 Minus
2L 23513712 2L 5957259..5957340 282..363 230 85.4 Plus
2L 23513712 2L 5957331..5957412 210..291 230 85.4 Plus
Blast to na_te.dros performed 2014-11-26 14:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 10408..10496 375..289 108 63 Minus

BO28148.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:53 Download gff for BO28148.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Ab-RA 63..566 17..522 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:32 Download gff for BO28148.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Ab-RA 63..566 17..522 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:49 Download gff for BO28148.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Ab-RA 63..566 17..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:49 Download gff for BO28148.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5957066..5957569 17..522 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:32 Download gff for BO28148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5957066..5957569 17..522 99   Plus

BO28148.pep Sequence

Translation from 16 to 538

> BO28148.pep
MAFNFGHLLIAGLVALSAVSSETIQLQPTQGILIPAPLAENIRVSRAAYG
GYGAAPAAPSYSAPAAPAAQAYSAPAAPAYSAPAAPAYSAPAAPAYSAPA
APAYSAPAAPAYSAPASIPSPPCPKNYLFSCQPSLQPVPCSAPAQSYGSA
GAYSQYVPQYAVPFVRELASFLDH

BO28148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15591-PA 163 GF15591-PA 113..163 118..168 250 96.1 Plus
Dana\GF21650-PA 118 GF21650-PA 68..112 117..161 194 86.7 Plus
Dana\GF14293-PA 147 GF14293-PA 77..127 118..163 158 70.6 Plus
Dana\GF15128-PA 105 GF15128-PA 24..68 116..160 155 64.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25107-PA 174 GG25107-PA 124..174 118..168 264 100 Plus
Dere\GG10199-PA 119 GG10199-PA 68..113 116..161 192 84.8 Plus
Dere\GG24269-PA 142 GG24269-PA 72..117 118..163 169 78.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11015-PA 170 GH11015-PA 124..169 123..168 224 93.5 Plus
Dgri\GH11097-PA 106 GH11097-PA 55..100 116..161 187 82.6 Plus
Dgri\GH10720-PA 130 GH10720-PA 62..107 118..163 171 76.1 Plus
Dgri\GH10719-PA 144 GH10719-PA 76..121 118..163 167 71.7 Plus
Dgri\GH24704-PA 692 GH24704-PA 449..522 54..116 142 66.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Ab-PB 168 CG9046-PB 1..168 1..168 866 100 Plus
Vm26Ab-PA 168 CG9046-PA 1..168 1..168 866 100 Plus
Vm34Ca-PA 119 CG9271-PA 32..113 50..161 302 58.9 Plus
Vml-PB 578 CG34333-PB 154..275 54..163 299 57.7 Plus
Vml-PA 578 CG34333-PA 154..275 54..163 299 57.7 Plus
Vml-PB 578 CG34333-PB 98..212 54..163 292 58.1 Plus
Vml-PB 578 CG34333-PB 320..434 54..163 291 57.5 Plus
Vml-PB 578 CG34333-PB 122..236 54..163 289 57.8 Plus
Vml-PB 578 CG34333-PB 50..180 28..163 288 53.2 Plus
Vml-PB 578 CG34333-PB 344..450 54..163 287 59.5 Plus
Vml-PB 578 CG34333-PB 186..298 54..163 277 56 Plus
Vml-PB 578 CG34333-PB 392..577 54..148 267 39.7 Plus
Vml-PB 578 CG34333-PB 288..426 54..163 258 49.3 Plus
Vml-PB 578 CG34333-PB 218..386 17..163 253 42.1 Plus
Vml-PB 578 CG34333-PB 345..462 36..154 252 51.2 Plus
Vml-PB 578 CG34333-PB 179..314 36..163 223 44.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17534-PA 155 GI17534-PA 109..154 123..168 225 93.5 Plus
Dmoj\GI18220-PA 121 GI18220-PA 71..115 117..161 191 84.4 Plus
Dmoj\GI11326-PA 132 GI11326-PA 62..112 118..163 171 70.6 Plus
Dmoj\GI11336-PA 128 GI11336-PA 58..103 118..163 167 71.7 Plus
Dmoj\GI18145-PA 82 GI18145-PA 13..73 108..174 147 52.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19046-PA 95 GL19046-PA 43..94 117..168 246 92.3 Plus
Dper\GL25706-PA 132 GL25706-PA 81..126 116..161 191 84.8 Plus
Dper\GL19099-PA 147 GL19099-PA 76..126 118..163 170 76.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21501-PA 177 GA21501-PA 126..176 118..168 246 94.1 Plus
Dpse\GA25403-PA 132 GA25403-PA 81..126 116..161 191 84.8 Plus
Dpse\GA21661-PA 132 GA21661-PA 81..126 116..161 191 84.8 Plus
Dpse\GA21503-PA 147 GA21503-PA 76..126 118..163 170 76.5 Plus
Dpse\GA22863-PA 610 GA22863-PA 10..153 8..116 148 45.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18584-PA 168 GM18584-PA 1..168 1..168 770 100 Plus
Dsec\GM25531-PA 119 GM25531-PA 68..113 116..161 192 84.8 Plus
Dsec\GM17983-PA 141 GM17983-PA 72..122 118..163 171 76.5 Plus
Dsec\GM11107-PA 118 GM11107-PA 21..81 96..160 163 61.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23372-PA 168 GD23372-PA 1..168 1..168 764 99.4 Plus
Dsim\GD22620-PA 141 GD22620-PA 72..122 118..163 171 76.5 Plus
Dsim\GD22183-PA 118 GD22183-PA 38..81 119..160 146 65.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15426-PA 178 GJ15426-PA 127..177 118..168 260 96.1 Plus
Dvir\GJ18127-PA 121 GJ18127-PA 71..116 116..161 182 78.3 Plus
Dvir\GJ12592-PA 133 GJ12592-PA 63..113 118..163 169 74.5 Plus
Dvir\GJ12581-PA 140 GJ12581-PA 70..120 118..163 166 74.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14709-PA 158 GK14709-PA 108..157 118..168 225 90.2 Plus
Dwil\GK15281-PA 111 GK15281-PA 60..105 117..161 184 84.8 Plus
Dwil\GK15410-PA 142 GK15410-PA 71..122 118..163 157 73.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25756-PA 167 GE25756-PA 117..167 118..168 264 100 Plus
Dyak\GE11602-PA 119 GE11602-PA 68..113 116..161 192 84.8 Plus
Dyak\GE18966-PA 141 GE18966-PA 71..116 118..163 162 76.1 Plus
Dyak\GE12948-PA 115 GE12948-PA 41..79 123..161 139 66.7 Plus