Clone BO28160 Report

Search the DGRC for BO28160

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG18343-RA
Protein status:BO28160.pep: Imported from assembly
Sequenced Size:331

Clone Sequence Records

BO28160.complete Sequence

331 bp assembled on 2011-06-17

GenBank Submission: KX796939

> BO28160.complete
GAAGTTATCAGTCGACATGGAGAAAAGCTGCAGTATTGGCAACGGACGGG
AGCAATACGGCTGGGGACATGGCGAACAATGCGGCACGCAGTTCCTTGAA
TGTGTCTACAGGAACGCGTCCATGTACTCTGTTCTGGGCGATCTGATCAC
ATACGTGGTGTTCCTGGGGGCTACGTGCTACGCAATACTTTTCGGCTTCC
GACTGTTGCTGTCCTGCGTGCGAATCGTCCTCAAAGTGGTTATCGCCCTC
TTCGTCATCCGATTGCTGCTAGCTTTGGGCTCCGTCGACATCACATCTGT
TAGCTATTCCGGGGCAAGCTTTCTAGACCAT

BO28160.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-RB 300 CG18343-PB 1..297 17..313 1485 100 Plus
CG18343-RA 300 CG18343-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-RB 630 CG18343-RB 162..460 15..313 1495 100 Plus
CG18343-RA 449 CG18343-RA 70..368 15..313 1495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12138856..12139154 15..313 1495 100 Plus
Blast to na_te.dros performed 2014-11-26 14:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
diver 6112 diver Tinker 6112bp 2607..2674 178..115 105 66.2 Minus

BO28160.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:57 Download gff for BO28160.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 57..353 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:06 Download gff for BO28160.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 72..368 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:26 Download gff for BO28160.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 72..368 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:26 Download gff for BO28160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12138858..12139154 17..315 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:06 Download gff for BO28160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026363..8026659 17..315 99   Plus

BO28160.pep Sequence

Translation from 16 to 331

> BO28160.pep
MEKSCSIGNGREQYGWGHGEQCGTQFLECVYRNASMYSVLGDLITYVVFL
GATCYAILFGFRLLLSCVRIVLKVVIALFVIRLLLALGSVDITSVSYSGA
SFLDH

BO28160.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-PB 99 CG18343-PB 1..99 1..99 510 100 Plus
CG18343-PA 99 CG18343-PA 1..99 1..99 510 100 Plus