Clone BO28171 Report

Search the DGRC for BO28171

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG14635-RA
Protein status:BO28171.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO28171.complete Sequence

391 bp assembled on 2011-06-17

GenBank Submission: KX795493

> BO28171.complete
GAAGTTATCAGTCGACATGTGCTCTAGTTTAAGCGACTTGTTTGCCTGTA
TCAGGGCCCAGGGAAATTCCGACACGGATTCCACCAGCACCACCCATCGG
CGGAATATCGCTGACCTGGACGATGAGGCGCCCGATCTGCAGCTCCAACA
GGAGCAGACCCGCAAGTGGAACGATCTTTCTATGCCACAGCGACACGATT
CGTTTCCAGTTCCTCCTCCTTCAGCTGGATCTCCATCAACGGGCTACCTT
CGTCCCTCATTGCGGTCAGCACGGGTCTCCTACGAAGCCTTGGAGCGCTA
CGATCGAATTTTTGGCAGATCTTTCCAAGACGCCGGGTCATCTGGTTCAG
TTCGAAATATTCCCGACCAGTTCGCAAGCTTTCTAGACCAT

BO28171.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-RA 360 CG14635-PA 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-RA 475 CG14635-RA 15..371 17..373 1785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 844837..845193 17..373 1785 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:59:16 has no hits.

BO28171.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:00 Download gff for BO28171.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..357 17..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:31 Download gff for BO28171.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 15..371 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:09 Download gff for BO28171.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 15..371 17..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:09 Download gff for BO28171.complete
Subject Subject Range Query Range Percent Splice Strand
X 844837..845193 17..375 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:31 Download gff for BO28171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 738870..739226 17..375 99   Plus

BO28171.pep Sequence

Translation from 16 to 391

> BO28171.pep
MCSSLSDLFACIRAQGNSDTDSTSTTHRRNIADLDDEAPDLQLQQEQTRK
WNDLSMPQRHDSFPVPPPSAGSPSTGYLRPSLRSARVSYEALERYDRIFG
RSFQDAGSSGSVRNIPDQFASFLDH

BO28171.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-PA 119 CG14635-PA 1..119 1..119 624 100 Plus