Clone BO28172 Report

Search the DGRC for BO28172

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG15526-RA
Protein status:BO28172.pep: Imported from assembly
Sequenced Size:370

Clone Sequence Records

BO28172.complete Sequence

370 bp assembled on 2011-06-17

GenBank Submission: KX797494

> BO28172.complete
GAAGTTATCAGTCGACATGGCGAACTATTACTATTTCGACATCAAACTTA
AACTTCGGGATCCGACTGCAGTTGCTTTGACCCCATCTCTGTTTCGAAGC
TGCGTTCTTGACGCCCTGGACAGTTTCTTCTGCGAGGAGAAACCCACACT
GGAGATCGTGAAGTTCTGCGCCCAGCAACATCGTGTTATCTTTCGAGTGC
CAGAGCAACTGCACGACATGACCCGCATATCCATTGAGCTCATCGGTCAC
TACCAGCAGATACCCTGTCATTTTGAGATCTTGGAAACATCCAAATCATC
GCTGGACTTTGAGAAGAGCATTGAAAAGACTGTCGCGGTTGTGTCCGATG
ATGCAAGCTTTCTAGACCAT

BO28172.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-RA 339 CG15526-PA 1..336 17..352 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-RA 566 CG15526-RA 179..515 16..352 1685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30056249..30056552 49..352 1520 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:59:27 has no hits.

BO28172.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:01 Download gff for BO28172.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..336 17..354 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:32 Download gff for BO28172.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 180..515 17..354 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:13 Download gff for BO28172.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 180..515 17..354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:13 Download gff for BO28172.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30056136..30056167 17..48 100 -> Plus
3R 30056249..30056552 49..354 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:32 Download gff for BO28172.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25881858..25881889 17..48 100 -> Plus
arm_3R 25881971..25882274 49..354 99   Plus

BO28172.pep Sequence

Translation from 16 to 370

> BO28172.pep
MANYYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCEEKPTLEIVKF
CAQQHRVIFRVPEQLHDMTRISIELIGHYQQIPCHFEILETSKSSLDFEK
SIEKTVAVVSDDASFLDH

BO28172.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-PA 112 CG15526-PA 1..112 1..112 581 100 Plus
CG34317-PA 111 CG34317-PA 1..109 1..107 283 51.4 Plus