Clone BO28180 Report

Search the DGRC for BO28180

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptCG42872-RA
Protein status:BO28180.pep: Imported from assembly
Sequenced Size:157

Clone Sequence Records

BO28180.complete Sequence

157 bp assembled on 2011-06-21

GenBank Submission: KX796246

> BO28180.complete
GAAGTTATCAGTCGACATGCCTTGCAAGGGATGTGGAAACAACTGCCAGT
GCTCAGCCGGAAAGTGCGGAGGTAACTGCGCCGGAAACAGCCAATGCCAA
TGCGCCGCCAAGACGGGAGCCAAGTGCTGCCAGGCCAAGGCAAGCTTTCT
AGACCAT

BO28180.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
MtnE-RA 126 CG42872-PA 1..123 17..139 615 100 Plus
MtnE-RB 126 CG42872-PB 1..123 17..139 615 100 Plus
MtnB-RC 132 CG4312-PC 6..73 22..89 175 83.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
MtnE-RA 344 CG42872-RA 71..193 17..139 615 100 Plus
MtnE-RB 604 CG42872-RB 71..193 17..139 615 100 Plus
MtnB-RC 456 CG4312-RC 94..161 22..89 175 83.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20534432..20534529 139..42 490 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:12:43 has no hits.

BO28180.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:37 Download gff for BO28180.complete
Subject Subject Range Query Range Percent Splice Strand
CG42872-RA 71..193 17..141 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:44 Download gff for BO28180.complete
Subject Subject Range Query Range Percent Splice Strand
MtnE-RA 71..193 17..141 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:42 Download gff for BO28180.complete
Subject Subject Range Query Range Percent Splice Strand
MtnE-RB 71..193 17..141 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:42 Download gff for BO28180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20534429..20534529 42..141 98 <- Minus
3R 20534610..20534634 17..41 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:44 Download gff for BO28180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16360151..16360251 42..141 98 <- Minus
arm_3R 16360332..16360356 17..41 100   Minus

BO28180.pep Sequence

Translation from 16 to 157

> BO28180.pep
MPCKGCGNNCQCSAGKCGGNCAGNSQCQCAAKTGAKCCQAKASFLDH

BO28180.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
MtnE-PA 41 CG42872-PA 1..41 1..41 250 100 Plus
MtnE-PB 41 CG42872-PB 1..41 1..41 250 100 Plus
MtnB-PC 43 CG4312-PC 1..43 1..41 160 65.1 Plus
MtnB-PB 43 CG4312-PB 1..43 1..41 160 65.1 Plus
MtnB-PA 43 CG4312-PA 1..43 1..41 160 65.1 Plus