BO28180.complete Sequence
157 bp assembled on 2011-06-21
GenBank Submission: KX796246
> BO28180.complete
GAAGTTATCAGTCGACATGCCTTGCAAGGGATGTGGAAACAACTGCCAGT
GCTCAGCCGGAAAGTGCGGAGGTAACTGCGCCGGAAACAGCCAATGCCAA
TGCGCCGCCAAGACGGGAGCCAAGTGCTGCCAGGCCAAGGCAAGCTTTCT
AGACCAT
BO28180.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnE-RA | 126 | CG42872-PA | 1..123 | 17..139 | 615 | 100 | Plus |
MtnE-RB | 126 | CG42872-PB | 1..123 | 17..139 | 615 | 100 | Plus |
MtnB-RC | 132 | CG4312-PC | 6..73 | 22..89 | 175 | 83.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnE-RA | 344 | CG42872-RA | 71..193 | 17..139 | 615 | 100 | Plus |
MtnE-RB | 604 | CG42872-RB | 71..193 | 17..139 | 615 | 100 | Plus |
MtnB-RC | 456 | CG4312-RC | 94..161 | 22..89 | 175 | 83.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 20534432..20534529 | 139..42 | 490 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:12:43 has no hits.
BO28180.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:37 Download gff for
BO28180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42872-RA | 71..193 | 17..141 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:44 Download gff for
BO28180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnE-RA | 71..193 | 17..141 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:42 Download gff for
BO28180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnE-RB | 71..193 | 17..141 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:42 Download gff for
BO28180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20534429..20534529 | 42..141 | 98 | <- | Minus |
3R | 20534610..20534634 | 17..41 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:44 Download gff for
BO28180.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 16360151..16360251 | 42..141 | 98 | <- | Minus |
arm_3R | 16360332..16360356 | 17..41 | 100 | | Minus |
BO28180.pep Sequence
Translation from 16 to 157
> BO28180.pep
MPCKGCGNNCQCSAGKCGGNCAGNSQCQCAAKTGAKCCQAKASFLDH
BO28180.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnE-PA | 41 | CG42872-PA | 1..41 | 1..41 | 250 | 100 | Plus |
MtnE-PB | 41 | CG42872-PB | 1..41 | 1..41 | 250 | 100 | Plus |
MtnB-PC | 43 | CG4312-PC | 1..43 | 1..41 | 160 | 65.1 | Plus |
MtnB-PB | 43 | CG4312-PB | 1..43 | 1..41 | 160 | 65.1 | Plus |
MtnB-PA | 43 | CG4312-PA | 1..43 | 1..41 | 160 | 65.1 | Plus |