Clone BO28183 Report

Search the DGRC for BO28183

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG42841-RA
Protein status:BO28183.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO28183.complete Sequence

271 bp assembled on 2011-06-17

GenBank Submission: KX795939

> BO28183.complete
GAAGTTATCAGTCGACATGGACCACTCATTTCCCAGCATGCCACCAAATA
TTTATCCGGAGTGGAGTGACGCACGCACCTCAAGCATTAGCAATGGAAAT
CTCGTAGACCCAAAACTAGACCTGTTCTTCCTGATGAGGTCATATCAGTT
TCCACTGCCGCCTCTCTACTCCCGTAGAGAATTTCGTTGGAGCCTCGAGG
GATCTCCGCTGTCGGACGACGAGAAACGTGCTTATAACGATTCCATGATC
GAGGCAAGCTTTCTAGACCAT

BO28183.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42841-RA 240 CG42841-PA 1..237 17..253 1185 100 Plus
CG42841-RB 240 CG42841-PB 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG42841-RA 577 CG42841-RA 106..342 17..253 1185 100 Plus
CG42841-RB 1087 CG42841-RB 106..342 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2005310..2005546 253..17 1185 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:07:40 has no hits.

BO28183.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:15 Download gff for BO28183.complete
Subject Subject Range Query Range Percent Splice Strand
CG42841-RA 106..342 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:27 Download gff for BO28183.complete
Subject Subject Range Query Range Percent Splice Strand
CG42841-RB 106..342 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:01 Download gff for BO28183.complete
Subject Subject Range Query Range Percent Splice Strand
CG42841-RB 106..342 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:01 Download gff for BO28183.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2005308..2005546 17..255 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:27 Download gff for BO28183.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2005308..2005546 17..255 99   Minus

BO28183.pep Sequence

Translation from 16 to 271

> BO28183.pep
MDHSFPSMPPNIYPEWSDARTSSISNGNLVDPKLDLFFLMRSYQFPLPPL
YSRREFRWSLEGSPLSDDEKRAYNDSMIEASFLDH

BO28183.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42841-PA 79 CG42841-PA 1..79 1..79 428 100 Plus
CG42841-PB 79 CG42841-PB 1..79 1..79 428 100 Plus