BO28183.complete Sequence
271 bp assembled on 2011-06-17
GenBank Submission: KX795939
> BO28183.complete
GAAGTTATCAGTCGACATGGACCACTCATTTCCCAGCATGCCACCAAATA
TTTATCCGGAGTGGAGTGACGCACGCACCTCAAGCATTAGCAATGGAAAT
CTCGTAGACCCAAAACTAGACCTGTTCTTCCTGATGAGGTCATATCAGTT
TCCACTGCCGCCTCTCTACTCCCGTAGAGAATTTCGTTGGAGCCTCGAGG
GATCTCCGCTGTCGGACGACGAGAAACGTGCTTATAACGATTCCATGATC
GAGGCAAGCTTTCTAGACCAT
BO28183.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:07:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42841-RA | 240 | CG42841-PA | 1..237 | 17..253 | 1185 | 100 | Plus |
CG42841-RB | 240 | CG42841-PB | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:07:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42841-RA | 577 | CG42841-RA | 106..342 | 17..253 | 1185 | 100 | Plus |
CG42841-RB | 1087 | CG42841-RB | 106..342 | 17..253 | 1185 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:07:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 2005310..2005546 | 253..17 | 1185 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:07:40 has no hits.
BO28183.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:15 Download gff for
BO28183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42841-RA | 106..342 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:27 Download gff for
BO28183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42841-RB | 106..342 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:01 Download gff for
BO28183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42841-RB | 106..342 | 17..255 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:01 Download gff for
BO28183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 2005308..2005546 | 17..255 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:27 Download gff for
BO28183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 2005308..2005546 | 17..255 | 99 | | Minus |
BO28183.pep Sequence
Translation from 16 to 271
> BO28183.pep
MDHSFPSMPPNIYPEWSDARTSSISNGNLVDPKLDLFFLMRSYQFPLPPL
YSRREFRWSLEGSPLSDDEKRAYNDSMIEASFLDH
BO28183.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:31:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42841-PA | 79 | CG42841-PA | 1..79 | 1..79 | 428 | 100 | Plus |
CG42841-PB | 79 | CG42841-PB | 1..79 | 1..79 | 428 | 100 | Plus |