Clone BO28189 Report

Search the DGRC for BO28189

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG13062-RB
Protein status:BO28189.pep: Inserted from web
Sequenced Size:388

Clone Sequence Records

BO28189.complete Sequence

388 bp assembled on 2011-06-17

GenBank Submission: KX796337

> BO28189.complete
GAAGTTATCAGTCGACATGATGAAACTGGTAGTGTCGCTACTCTCAATTT
GCGCCTTGACGGCAGCTCGTCCTGGTTTCCTGCATGGCCACCACCATCAC
TATCCGGAAATCCCTTACTATCCACACCACCATCATGTGGAACCACTGCA
CTACCATCTGCCCGCCGCCGTCTCCCACCAGAGCTCCACGGTGGTGCACA
GTGTGCCGCACCACATAATCAAGCCGGTCCTGCTGCCCACTGTGGTGAAG
ACAGTGGTGCATCCGCCCATCATCAAGGCTTATCATCCTGCGCCCATCAT
CAAGGCCTACCACCCCTACGATCCCTTCCATCTGCATCACCATCACGACT
TCCACGACTACCATCTGCACGCAAGCTTTCTAGACCAT

BO28189.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-RB 357 CG13062-PB 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-RB 801 CG13062-RB 243..596 17..370 1770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16314602..16314944 28..370 1715 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:10:53 has no hits.

BO28189.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:20 Download gff for BO28189.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 243..596 17..372 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:12 Download gff for BO28189.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 243..596 17..372 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:00 Download gff for BO28189.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 243..596 17..372 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:00 Download gff for BO28189.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16314602..16314944 28..372 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:12 Download gff for BO28189.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16307702..16308044 28..372 99   Plus

BO28189.pep Sequence

Translation from 16 to 388

> BO28189.pep
MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPA
AVSHQSSTVVHSVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAYHP
YDPFHLHHHHDFHDYHLHASFLDH

BO28189.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24179-PA 122 GF24179-PA 1..108 1..104 427 85.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15983-PA 155 GG15983-PA 40..155 3..118 548 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15874-PA 115 GH15874-PA 1..105 1..104 354 81.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-PB 118 CG13062-PB 1..118 1..118 681 100 Plus
CG14147-PA 153 CG14147-PA 1..122 2..124 136 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16524-PA 121 GI16524-PA 18..106 18..103 298 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17849-PA 126 GL17849-PA 1..109 1..104 329 85.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28512-PA 126 GA28512-PA 1..109 1..104 329 85.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25615-PA 200 GM25615-PA 87..200 5..118 556 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14620-PA 200 GD14620-PA 87..200 5..118 559 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12777-PA 122 GJ12777-PA 18..103 18..98 266 81.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16557-PA 120 GK16557-PA 1..103 1..101 285 80.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23178-PA 160 GE23178-PA 45..146 3..104 436 94.1 Plus
Dyak\GE23098-PA 160 GE23098-PA 45..146 3..104 431 93.1 Plus