Clone BO28250 Report

Search the DGRC for BO28250

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:282
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG7224-RA
Protein status:BO28250.pep: Imported from assembly
Sequenced Size:388

Clone Sequence Records

BO28250.complete Sequence

388 bp assembled on 2012-10-15

GenBank Submission: KX799538

> BO28250.complete
GAAGTTATCACTCGGCATGCAATCCGTGACCAGACAAACGGCGCGAGTCC
TGCCCCAAATGGGCAAACAAGTGAGCTATCTATCGACGAGTGGCGCTTGG
CGGGCAACCGCCAGCGGTGGCGACATGGTGGTCGAGATCAAGGAACCAAA
GACGCGCACCGAGAAGCTAATGGCCTTCCAGAAGAAGCTGCGCGCTAAAA
CGCCGCTGGGCAAGCTGGATGAATTCTCGCGACATCCGTACCAGGAGAAG
GAACCACTCAAGCCCTGGCCCAATCAGACCAATCCGTATACGGGCGAGAT
CGGCGGACCAGCCGGGCCGGAGCCCACACGCTACGGCGACTGGGAGCGCA
AGGGACGCGTCTCCGATTTCGCAAGCTTTCTAGACCAT

BO28250.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Sirup-RC 357 CG7224-PC 1..354 17..370 1770 100 Plus
Sirup-RA 357 CG7224-PA 1..354 17..370 1770 100 Plus
CG15283-RB 381 CG15283-PB 240..378 232..370 335 82.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Sirup-RC 727 CG7224-RC 245..598 17..370 1770 100 Plus
Sirup-RA 650 CG7224-RA 168..521 17..370 1770 100 Plus
CG15283-RB 641 CG15283-RB 302..440 232..370 335 82.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7999247..7999547 70..370 1505 100 Plus
2L 23513712 2L 14450483..14450621 370..232 335 82.7 Minus
2L 23513712 2L 7999113..7999167 17..71 275 100 Plus
Blast to na_te.dros performed on 2014-11-28 12:36:03 has no hits.

BO28250.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-10-15 09:58:46 Download gff for BO28250.complete
Subject Subject Range Query Range Percent Splice Strand
CG7224-RA 180..533 17..372 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:55:33 Download gff for BO28250.complete
Subject Subject Range Query Range Percent Splice Strand
Sirup-RA 168..521 17..372 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:07:35 Download gff for BO28250.complete
Subject Subject Range Query Range Percent Splice Strand
Sirup-RA 168..521 17..372 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:07:35 Download gff for BO28250.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7999113..7999167 17..71 100 -> Plus
2L 7999249..7999547 72..372 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:55:33 Download gff for BO28250.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7999113..7999167 17..71 100 -> Plus
arm_2L 7999249..7999547 72..372 99   Plus

BO28250.pep Sequence

Translation from 16 to 388

> BO28250.pep
MQSVTRQTARVLPQMGKQVSYLSTSGAWRATASGGDMVVEIKEPKTRTEK
LMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAG
PEPTRYGDWERKGRVSDFASFLDH

BO28250.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Sirup-PC 118 CG7224-PC 1..118 1..118 632 100 Plus
Sirup-PA 118 CG7224-PA 1..118 1..118 632 100 Plus
CG15283-PB 126 CG15283-PB 56..126 48..118 289 70.4 Plus