Clone BO28275 Report

Search the DGRC for BO28275

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:282
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG42465-RA
Protein status:BO28275.pep: Imported from assembly
Sequenced Size:253

Clone Sequence Records

BO28275.complete Sequence

253 bp assembled on 2011-06-21

GenBank Submission: KX798218

> BO28275.complete
GAAGTTATCAGTCGACATGAAAGTATATATTTTGATCTGGACAATATTAG
CTCTAACGGCGGATATAAATGGCTTGGTTTGTAATCTTGAACCTTTTGTC
CAAGGATCATGCCTGGAATTGACAGACCTCTATTCCTATGTTGAATATAA
AAACGATTGTGTATACTGGCAGGGATGCCTTCTGAATGGAAATCATTTTA
GCAAAAAAGAGGAGTGCGAAGACATGTGCAAGCAAGCAAGCTTTCTAGAC
CAT

BO28275.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-RA 222 CG42465-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-RA 401 CG42465-RA 51..269 17..235 1095 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700366..3700526 75..235 805 100 Plus
2L 23513712 2L 3700245..3700302 17..74 290 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:15:05 has no hits.

BO28275.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:58:10 Download gff for BO28275.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..219 17..237 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:16 Download gff for BO28275.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 51..269 17..237 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:36 Download gff for BO28275.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 51..269 17..237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:36 Download gff for BO28275.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700366..3700526 75..237 98   Plus
2L 3700245..3700302 17..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:16 Download gff for BO28275.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3700245..3700302 17..74 100 -> Plus
arm_2L 3700366..3700526 75..237 98   Plus

BO28275.pep Sequence

Translation from 16 to 253

> BO28275.pep
MKVYILIWTILALTADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDCVY
WQGCLLNGNHFSKKEECEDMCKQASFLDH

BO28275.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-PA 73 CG42465-PA 1..73 1..73 407 100 Plus