BO28275.complete Sequence
253 bp assembled on 2011-06-21
GenBank Submission: KX798218
> BO28275.complete
GAAGTTATCAGTCGACATGAAAGTATATATTTTGATCTGGACAATATTAG
CTCTAACGGCGGATATAAATGGCTTGGTTTGTAATCTTGAACCTTTTGTC
CAAGGATCATGCCTGGAATTGACAGACCTCTATTCCTATGTTGAATATAA
AAACGATTGTGTATACTGGCAGGGATGCCTTCTGAATGGAAATCATTTTA
GCAAAAAAGAGGAGTGCGAAGACATGTGCAAGCAAGCAAGCTTTCTAGAC
CAT
BO28275.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-RA | 222 | CG42465-PA | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:15:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-RA | 401 | CG42465-RA | 51..269 | 17..235 | 1095 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700366..3700526 | 75..235 | 805 | 100 | Plus |
2L | 23513712 | 2L | 3700245..3700302 | 17..74 | 290 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:15:05 has no hits.
BO28275.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:58:10 Download gff for
BO28275.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..219 | 17..237 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:16 Download gff for
BO28275.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 51..269 | 17..237 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:36 Download gff for
BO28275.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 51..269 | 17..237 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:36 Download gff for
BO28275.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700366..3700526 | 75..237 | 98 | | Plus |
2L | 3700245..3700302 | 17..74 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:16 Download gff for
BO28275.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3700245..3700302 | 17..74 | 100 | -> | Plus |
arm_2L | 3700366..3700526 | 75..237 | 98 | | Plus |
BO28275.pep Sequence
Translation from 16 to 253
> BO28275.pep
MKVYILIWTILALTADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDCVY
WQGCLLNGNHFSKKEECEDMCKQASFLDH
BO28275.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-PA | 73 | CG42465-PA | 1..73 | 1..73 | 407 | 100 | Plus |