Clone BO28306 Report

Search the DGRC for BO28306

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG10332-RA
Protein status:BO28306.pep: Imported from assembly
Sequenced Size:367

Clone Sequence Records

BO28306.complete Sequence

367 bp assembled on 2011-06-27

GenBank Submission: KX799397

> BO28306.complete
GAAGTTATCAGTCGACATGGACATTAACCCAATAATCAGATCTATTCTCA
GCCGCTTCAGAGGCTGCACCATCAGAAGTTATCTGGTTGTTCTGCCCGAT
CAGAGTCGCATAGAAAATCAACTAAAACTGGAGGATCTGCAAACAGAACG
CGGAATCTTGGATCTGCAATCCCATGAGCTGGCACTCAAGCAAAAGCGCG
TCGAGGCCAATCTAACCGACCTGACCCGCTGCATCCGTGGCATGGAGTTC
GATGTGAAGGTGAATTCCAATCGCGAGAGGAAGGAGAGAAAATCTGATCG
ACGCCCCCCAGCTGATAAGAAATCACCCAAAGTCGGTGATTTCAGCGAAG
CAAGCTTTCTAGACCAT

BO28306.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-RA 336 CG10332-PA 1..333 17..349 1650 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-RA 739 CG10332-RA 41..374 16..349 1655 99.7 Plus
IM18-RA 739 CG33706-RA 41..374 16..349 1655 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23601279..23601482 349..146 1020 100 Minus
2R 25286936 2R 23601550..23601622 146..74 350 98.6 Minus
2R 25286936 2R 23601674..23601733 75..16 300 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:48:10 has no hits.

BO28306.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:24:52 Download gff for BO28306.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 42..374 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:56 Download gff for BO28306.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 42..374 17..351 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:03 Download gff for BO28306.complete
Subject Subject Range Query Range Percent Splice Strand
IM18-RA 42..374 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:03 Download gff for BO28306.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23601275..23601482 146..351 99 <- Minus
2R 23601551..23601620 76..145 98 <- Minus
2R 23601674..23601732 17..75 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:56 Download gff for BO28306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19488798..19489005 146..351 99 <- Minus
arm_2R 19489074..19489143 76..145 98 <- Minus
arm_2R 19489197..19489255 17..75 100   Minus

BO28306.pep Sequence

Translation from 16 to 367

> BO28306.pep
MDINPIIRSILSRFRGCTIRSYLVVLPDQSRIENQLKLEDLQTERGILDL
QSHELALKQKRVEANLTDLTRCIRGMEFDVKVNSNRERKERKSDRRPPAD
KKSPKVGDFSEASFLDH

BO28306.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-PA 111 CG10332-PA 1..111 1..111 561 100 Plus