Clone BO28350 Report

Search the DGRC for BO28350

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG14391-RA
Protein status:BO28350.pep: Imported from assembly
Sequenced Size:439

Clone Sequence Records

BO28350.complete Sequence

439 bp assembled on 2011-06-27

GenBank Submission: KX800023

> BO28350.complete
GAAGTTATCAGTCGACATGGAATTTGCCATACCAGAGGCTCAGTACTGGG
ACGTTTCGAAGAAATCCCAAAAAGATCGTCAGATGATTCGTAAATTCGTG
CCCGAGGCGGTCGACCTGGCCACCATAAGTCGTGCAGAGATCTACAGGAT
TGACACATTCTATTTGGAGTGCCAAAAGTACCGGGATCACTATCGTGACC
CCTACGGCAAGGTCCACTGTCCGGCATTCTTCCACCTGCACAAGGGCAAG
TGCGGAATCAAGCTGGACCAGAGCGTCATCAAGATGACGCAGGCGATTGC
CGCAACTGTGGACCGGCAGCCCATAGTTTTTCCCCTGATTCCGAACAAGA
GCATGTTTTTGGGTGGTAGCATTCCCATGGGGTCACAAACATCCCAAGTT
GGCGTCACTAGCTATCTCAGAGCAAGCTTTCTAGACCAT

BO28350.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14391-RA 408 CG14391-PA 1..405 17..421 2025 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14391-RA 614 CG14391-RA 95..500 16..421 2030 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12694343..12694748 421..16 2030 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:53:06 has no hits.

BO28350.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:25:07 Download gff for BO28350.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 96..500 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:55 Download gff for BO28350.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 96..500 17..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:05:51 Download gff for BO28350.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 96..500 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:05:51 Download gff for BO28350.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12694340..12694747 17..423 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:55 Download gff for BO28350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8520062..8520469 17..423 99   Minus

BO28350.pep Sequence

Translation from 16 to 439

> BO28350.pep
MEFAIPEAQYWDVSKKSQKDRQMIRKFVPEAVDLATISRAEIYRIDTFYL
ECQKYRDHYRDPYGKVHCPAFFHLHKGKCGIKLDQSVIKMTQAIAATVDR
QPIVFPLIPNKSMFLGGSIPMGSQTSQVGVTSYLRASFLDH

BO28350.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14391-PA 135 CG14391-PA 1..135 1..135 713 100 Plus
CG31347-PA 143 CG31347-PA 4..132 3..132 262 38.5 Plus
CG13110-PA 133 CG13110-PA 3..112 5..116 229 42 Plus
CG43796-PA 127 CG43796-PA 4..109 13..119 212 40.2 Plus