Clone BO28356 Report

Search the DGRC for BO28356

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG33199-RA
Protein status:BO28356.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO28356.complete Sequence

271 bp assembled on 2011-06-27

GenBank Submission: KX798320

> BO28356.complete
GAAGTTATCAGTCGACATGAAAACAAGCAATCTCGGCCTGTACGCTTTCC
GTTTAACCTTCGGTCAGGCGCCGACGTTGTCCACACAGGCCACGACGCAC
TGCAGCCATGGCTTCACCACCAGCTCGTCGTCGCCCAACCGTGTGGTGAC
CCGCTCTGCCACCATGCTGGCGCTCTTCGGCATCGCGCTGTCCTCGTTCA
GCCTTAAGCAACTGCTGGCCAAGAAGCAGAAGCACCAGGGCCTGCGCAAG
CTCGCAAGCTTTCTAGACCAT

BO28356.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG33199-RB 240 CG33199-PB 1..237 17..253 1185 100 Plus
CG33199-RA 240 CG33199-PA 1..237 17..253 1185 100 Plus
CG8229-RE 882 CG8229-PE 741..882 66..207 710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33199-RB 1523 CG33199-RB 211..448 16..253 1190 100 Plus
CG33199-RA 1091 CG33199-RA 211..448 16..253 1190 100 Plus
CG8229-RE 1951 CG8229-RE 1121..1308 66..253 940 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8948756..8948944 253..65 945 100 Minus
2R 25286936 2R 8950705..8950757 68..16 265 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:53:46 has no hits.

BO28356.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:25:10 Download gff for BO28356.complete
Subject Subject Range Query Range Percent Splice Strand
CG33199-RA 230..466 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:47:10 Download gff for BO28356.complete
Subject Subject Range Query Range Percent Splice Strand
CG33199-RA 212..448 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:06:07 Download gff for BO28356.complete
Subject Subject Range Query Range Percent Splice Strand
CG33199-RA 212..448 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:06:07 Download gff for BO28356.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8948754..8948941 68..255 98 <- Minus
2R 8950706..8950756 17..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:10 Download gff for BO28356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4836259..4836446 68..255 98 <- Minus
arm_2R 4838211..4838261 17..67 100   Minus

BO28356.pep Sequence

Translation from 16 to 271

> BO28356.pep
MKTSNLGLYAFRLTFGQAPTLSTQATTHCSHGFTTSSSSPNRVVTRSATM
LALFGIALSSFSLKQLLAKKQKHQGLRKLASFLDH

BO28356.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33199-PB 79 CG33199-PB 1..79 1..79 393 100 Plus
CG33199-PA 79 CG33199-PA 1..79 1..79 393 100 Plus