BO28367.complete Sequence
247 bp assembled on 2011-06-28
GenBank Submission: KX797785
> BO28367.complete
GAAGTTATCAGTCGACATGAAGCTGATCGCATTGTGCTGCCTGCTCCTTT
TGGGCCTCCTGGGCTTCCTAGCTGCTCCCGGCGTCGCCTCGCCATCTCGC
CACACTGGACCAGGAAACGGATCGGGATCTGGAGCTGGGTCCGGAAATCC
GTTCAGGTCTCCAAGCTCACAGCAACGACCACTGTACTACGACGCTCCGA
TTGGGAAACCATCGAAGACTATGTACGCCGCAAGCTTTCTAGACCAT
BO28367.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:59:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM18-RB | 216 | CG33706-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
IM18-RA | 216 | CG33706-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10332-RA | 739 | CG10332-RA | 483..696 | 16..229 | 1070 | 100 | Plus |
IM18-RB | 286 | CG33706-RB | 30..243 | 16..229 | 1070 | 100 | Plus |
IM18-RA | 739 | CG33706-RA | 483..696 | 16..229 | 1070 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23600957..23601170 | 229..16 | 1070 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:59:53 has no hits.
BO28367.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:03:54 Download gff for
BO28367.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10332-RA | 484..696 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:49:43 Download gff for
BO28367.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10332-RA | 484..696 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:51 Download gff for
BO28367.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM18-RA | 484..696 | 17..231 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:51 Download gff for
BO28367.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23600953..23601169 | 17..231 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:49:43 Download gff for
BO28367.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19488476..19488692 | 17..231 | 99 | | Minus |
BO28367.pep Sequence
Translation from 16 to 247
> BO28367.pep
MKLIALCCLLLLGLLGFLAAPGVASPSRHTGPGNGSGSGAGSGNPFRSPS
SQQRPLYYDAPIGKPSKTMYAASFLDH
BO28367.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:47:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM18-PB | 71 | CG33706-PB | 1..71 | 1..71 | 375 | 100 | Plus |
IM18-PA | 71 | CG33706-PA | 1..71 | 1..71 | 375 | 100 | Plus |