Clone BO28367 Report

Search the DGRC for BO28367

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptIM18-RA
Protein status:BO28367.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO28367.complete Sequence

247 bp assembled on 2011-06-28

GenBank Submission: KX797785

> BO28367.complete
GAAGTTATCAGTCGACATGAAGCTGATCGCATTGTGCTGCCTGCTCCTTT
TGGGCCTCCTGGGCTTCCTAGCTGCTCCCGGCGTCGCCTCGCCATCTCGC
CACACTGGACCAGGAAACGGATCGGGATCTGGAGCTGGGTCCGGAAATCC
GTTCAGGTCTCCAAGCTCACAGCAACGACCACTGTACTACGACGCTCCGA
TTGGGAAACCATCGAAGACTATGTACGCCGCAAGCTTTCTAGACCAT

BO28367.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
IM18-RB 216 CG33706-PB 1..213 17..229 1065 100 Plus
IM18-RA 216 CG33706-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-RA 739 CG10332-RA 483..696 16..229 1070 100 Plus
IM18-RB 286 CG33706-RB 30..243 16..229 1070 100 Plus
IM18-RA 739 CG33706-RA 483..696 16..229 1070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23600957..23601170 229..16 1070 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:59:53 has no hits.

BO28367.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:03:54 Download gff for BO28367.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 484..696 17..231 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:49:43 Download gff for BO28367.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 484..696 17..231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:51 Download gff for BO28367.complete
Subject Subject Range Query Range Percent Splice Strand
IM18-RA 484..696 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:51 Download gff for BO28367.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600953..23601169 17..231 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:49:43 Download gff for BO28367.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19488476..19488692 17..231 99   Minus

BO28367.pep Sequence

Translation from 16 to 247

> BO28367.pep
MKLIALCCLLLLGLLGFLAAPGVASPSRHTGPGNGSGSGAGSGNPFRSPS
SQQRPLYYDAPIGKPSKTMYAASFLDH

BO28367.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
IM18-PB 71 CG33706-PB 1..71 1..71 375 100 Plus
IM18-PA 71 CG33706-PA 1..71 1..71 375 100 Plus