BO28368.complete Sequence
289 bp assembled on 2011-06-27
> BO28368.complete
GAAGTTATCAGTCGACATGGACGGCTTCTACAGCAACAGCAACAGTTGCA
GCAACAACGGCGGCTACTGCTCGCAGGGTTCGCGAAGTGGCAACTGCGGA
TCGTGTGGCAACTGCCCCGGTGGCCACTGCCCCCGAATGGAGGCGGGTGG
TAGTAGCTACGGCGCTCGAGGAATGAGCCAGCCGGGTTGTCCTGGCGGCA
ACTGTTGTCCCGGCGGAAGGTGTTCGGCCGGAAAGTCGCGCTTCAATCCA
GACTGGCAGTATGGTGGACGCGCACGCTTTCTAGACCAT
BO28368.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:54:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9016-RB | 258 | CG9016-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
CG9016-RA | 258 | CG9016-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9016-RB | 719 | CG9016-RB | 123..378 | 16..271 | 1280 | 100 | Plus |
CG9016-RA | 724 | CG9016-RA | 128..383 | 16..271 | 1280 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5923217..5923472 | 271..16 | 1280 | 100 | Minus |
Blast to na_te.dros performed 2014-11-26 15:54:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
roo | 9092 | roo DM_ROO 9092bp | 1114..1164 | 21..71 | 129 | 72.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2436..2485 | 22..71 | 124 | 72 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2374..2424 | 7..58 | 122 | 73.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2379..2415 | 28..64 | 122 | 81.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6761..6824 | 31..97 | 120 | 68.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6740..6779 | 31..70 | 119 | 77.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2576..2628 | 8..58 | 116 | 71.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6782..6815 | 31..64 | 116 | 82.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2613..2658 | 25..67 | 115 | 76.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6815..6854 | 31..70 | 110 | 75 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6803..6836 | 31..64 | 107 | 79.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2759..2883 | 1..127 | 106 | 57.8 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1059..1120 | 35..99 | 101 | 66.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1545..1575 | 31..61 | 101 | 80.6 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1097..1139 | 31..70 | 100 | 74.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6871..6917 | 21..67 | 100 | 68.1 | Plus |
BO28368.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:25:12 Download gff for
BO28368.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9016-RA | 122..376 | 17..273 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:47:33 Download gff for
BO28368.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9016-RA | 129..383 | 17..273 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:06:31 Download gff for
BO28368.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9016-RA | 129..383 | 17..273 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:06:31 Download gff for
BO28368.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5923213..5923471 | 17..273 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:33 Download gff for
BO28368.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5923213..5923471 | 17..273 | 99 | | Minus |
BO28368.pep Sequence
Translation from 16 to 289
> BO28368.pep
MDGFYSNSNSCSNNGGYCSQGSRSGNCGSCGNCPGGHCPRMEAGGSSYGA
RGMSQPGCPGGNCCPGGRCSAGKSRFNPDWQYGGRARFLDH
BO28368.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:46:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9016-PB | 85 | CG9016-PB | 1..85 | 1..85 | 511 | 100 | Plus |
CG9016-PA | 85 | CG9016-PA | 1..85 | 1..85 | 511 | 100 | Plus |