Clone BO28368 Report

Search the DGRC for BO28368

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG9016-RA
Protein status:BO28368.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO28368.complete Sequence

289 bp assembled on 2011-06-27

> BO28368.complete
GAAGTTATCAGTCGACATGGACGGCTTCTACAGCAACAGCAACAGTTGCA
GCAACAACGGCGGCTACTGCTCGCAGGGTTCGCGAAGTGGCAACTGCGGA
TCGTGTGGCAACTGCCCCGGTGGCCACTGCCCCCGAATGGAGGCGGGTGG
TAGTAGCTACGGCGCTCGAGGAATGAGCCAGCCGGGTTGTCCTGGCGGCA
ACTGTTGTCCCGGCGGAAGGTGTTCGGCCGGAAAGTCGCGCTTCAATCCA
GACTGGCAGTATGGTGGACGCGCACGCTTTCTAGACCAT

BO28368.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9016-RB 258 CG9016-PB 1..255 17..271 1275 100 Plus
CG9016-RA 258 CG9016-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9016-RB 719 CG9016-RB 123..378 16..271 1280 100 Plus
CG9016-RA 724 CG9016-RA 128..383 16..271 1280 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5923217..5923472 271..16 1280 100 Minus
Blast to na_te.dros performed 2014-11-26 15:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1114..1164 21..71 129 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2436..2485 22..71 124 72 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2374..2424 7..58 122 73.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2379..2415 28..64 122 81.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6824 31..97 120 68.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6779 31..70 119 77.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2576..2628 8..58 116 71.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6782..6815 31..64 116 82.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2613..2658 25..67 115 76.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6815..6854 31..70 110 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6803..6836 31..64 107 79.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2759..2883 1..127 106 57.8 Plus
roo 9092 roo DM_ROO 9092bp 1059..1120 35..99 101 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1545..1575 31..61 101 80.6 Plus
roo 9092 roo DM_ROO 9092bp 1097..1139 31..70 100 74.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6871..6917 21..67 100 68.1 Plus

BO28368.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:25:12 Download gff for BO28368.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 122..376 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:47:33 Download gff for BO28368.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 129..383 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:06:31 Download gff for BO28368.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 129..383 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:06:31 Download gff for BO28368.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5923213..5923471 17..273 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:33 Download gff for BO28368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5923213..5923471 17..273 99   Minus

BO28368.pep Sequence

Translation from 16 to 289

> BO28368.pep
MDGFYSNSNSCSNNGGYCSQGSRSGNCGSCGNCPGGHCPRMEAGGSSYGA
RGMSQPGCPGGNCCPGGRCSAGKSRFNPDWQYGGRARFLDH

BO28368.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9016-PB 85 CG9016-PB 1..85 1..85 511 100 Plus
CG9016-PA 85 CG9016-PA 1..85 1..85 511 100 Plus