Clone BO28375 Report

Search the DGRC for BO28375

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG33218-RA
Protein status:BO28375.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO28375.complete Sequence

295 bp assembled on 2011-06-27

GenBank Submission: KX799431

> BO28375.complete
GAAGTTATCAGTCGACATGGCTAAAATAAATCTTTGGTTGGGTAAACTCC
GTGACTCTGTTCTGTCCAGGCTGCAGAGCATCAAGAAACCCCTACCCCTT
CCTTCGACCAAGGGCCCCCTCAATGCCAATGAAACCTCAAATTCCGAAGG
TAATATTAGTGACTTTCAGCAGGGCGATCCAATAATTCCACCCATCGAAG
CTAACAAAATGATACCGAGGCCTCAAAATGGATTCGTCAGCCGAGCCCTC
TACTACCGAGGATACTACATTAGGCGTGCAAGCTTTCTAGACCAT

BO28375.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 15:55:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 15:55:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2330411..2330613 75..277 1015 100 Plus
X 23542271 X 2330296..2330355 17..76 300 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:55:46 has no hits.

BO28375.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:25:15 Download gff for BO28375.complete
Subject Subject Range Query Range Percent Splice Strand
CG33218-RA 138..398 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:06:58 Download gff for BO28375.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330296..2330355 17..76 100 -> Plus
X 2330413..2330613 77..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:06:58 Download gff for BO28375.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330296..2330355 17..76 100 -> Plus
X 2330413..2330613 77..279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:58 Download gff for BO28375.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224329..2224388 17..76 100 -> Plus
arm_X 2224446..2224646 77..279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:58 Download gff for BO28375.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224329..2224388 17..76 100 -> Plus
arm_X 2224446..2224646 77..279 99   Plus

BO28375.pep Sequence

Translation from 16 to 295

> BO28375.pep
MAKINLWLGKLRDSVLSRLQSIKKPLPLPSTKGPLNANETSNSEGNISDF
QQGDPIIPPIEANKMIPRPQNGFVSRALYYRGYYIRRASFLDH
Sequence BO28375.pep has no blast hits.