Clone BO28515 Report

Search the DGRC for BO28515

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG34296-RA
Protein status:BO28515.pep: Imported from assembly
Sequenced Size:328

Clone Sequence Records

BO28515.complete Sequence

328 bp assembled on 2011-07-13

> BO28515.complete
GAAGTTATCAGTCGACATGAAGCTGGCCCTGCTCCTGATCCTCTGCTGTT
GCCTCATCGGAATGGCGATTGGTGACTCGGTTTTGGTGACCAAGCCGCCG
TTCATTCGCAGTCGCTATAGCTTGCGTTGGAGGAAGACAACCACTGTGGC
GCCTGAAGTGGTCACTGGATCCAGTGGATCAACCGTTAACACGGTCACCA
CCACCGACCATCCCAAGCTGGCCACTTCCACCGCCAGTTCGGATTACGAC
TATTACGGAAATGGGGAGACGGAGAATGTGGTGCACAAGGCAAGCTTTCT
AGACCATTCGTTTGGCGCGCGGAAAGGG

BO28515.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-RA 276 CG34296-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-RA 420 CG34296-RA 22..294 17..289 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29722663..29722887 65..289 1125 100 Plus
3R 32079331 3R 29722559..29722607 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:49:17 has no hits.

BO28515.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:09 Download gff for BO28515.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 18..293 17..293 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:35 Download gff for BO28515.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 22..297 17..293 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:28:13 Download gff for BO28515.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 22..297 17..293 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:28:13 Download gff for BO28515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29722559..29722607 17..65 100 -> Plus
3R 29722664..29722890 66..293 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:35 Download gff for BO28515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25548281..25548329 17..65 100 -> Plus
arm_3R 25548386..25548612 66..293 99   Plus

BO28515.pep Sequence

Translation from 16 to 328

> BO28515.pep
MKLALLLILCCCLIGMAIGDSVLVTKPPFIRSRYSLRWRKTTTVAPEVVT
GSSGSTVNTVTTTDHPKLATSTASSDYDYYGNGETENVVHKASFLDHSFG
ARKG

BO28515.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-PA 91 CG34296-PA 1..91 1..91 473 100 Plus