Clone BO28590 Report

Search the DGRC for BO28590

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG12929-RA
Protein status:BO28590.pep: Imported from assembly
Sequenced Size:480

Clone Sequence Records

BO28590.complete Sequence

480 bp assembled on 2011-07-13

> BO28590.complete
GAAGTTATCAGTCGACATGCTGGATATCGCTGCACAACTCCTTGCCGTGG
GCCTCTTGTGGGGCGTTACCAATCCGTTTATTCGCCTCGGCAGCCAGGGA
ATCGAGTCGGTTGGTGATACGGGCTCAAAGTGGCGTAACTTTGTCCAGGA
GGCACGCACAATCGGCTCCCGGTGGCGCTATTGGATACCCTTCGGTCTCA
ACCAGTGCGGGAGTGCTCTGTACGTTTGGACGCTCCAGAGGGCCAGTATT
ACAGTGGCGGTGCCAGTGGCCAATTCCCTGAGCTTCGCATTTACGGCAAT
CACCGGATATGCGCTGGGGGAAAAACTGCCGGGAAGAAAAGTCATTCTGG
GCACCCTGCTCGTCTGCTGTGGCAGTATCCTGATGATATACGATAAGATT
TTGCAGGAACAGGCCCAGCACCAGCTAAATATAACATTCCACGCAAGCTT
TCTAGACCATTCGTTTGGCGCGCTAAAGGG

BO28590.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-RA 429 CG12929-PA 1..426 17..442 2130 100 Plus
CG12929-RB 339 CG12929-PB 1..322 17..338 1610 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-RA 493 CG12929-RA 50..475 17..442 2130 100 Plus
CG12929-RB 551 CG12929-RB 50..371 17..338 1610 100 Plus
CG12929-RB 551 CG12929-RB 430..533 339..442 520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9586290..9586596 338..32 1535 100 Minus
2R 25286936 2R 9586128..9586231 442..339 520 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:53:24 has no hits.

BO28590.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:16 Download gff for BO28590.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 11..443 17..450 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:12:21 Download gff for BO28590.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 50..482 17..450 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:52 Download gff for BO28590.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 50..482 17..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:52 Download gff for BO28590.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586290..9586595 33..338 100 <- Minus
2R 9586650..9586665 17..32 100   Minus
2R 9586121..9586231 339..450 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:12:21 Download gff for BO28590.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5473795..5474100 33..338 100 <- Minus
arm_2R 5474155..5474170 17..32 100   Minus
arm_2R 5473626..5473736 339..450 96 <- Minus

BO28590.pep Sequence

Translation from 16 to 478

> BO28590.pep
MLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEARTIG
SRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITGYAL
GEKLPGRKVILGTLLVCCGSILMIYDKILQEQAQHQLNITFHASFLDHSF
GALK

BO28590.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-PA 142 CG12929-PA 1..142 1..142 741 100 Plus
CG12929-PB 112 CG12929-PB 1..107 1..107 560 100 Plus