BO28701.complete Sequence
241 bp assembled on 2011-08-24
GenBank Submission: KX794235
> BO28701.complete
GAAGTTATCAGTCGACATGTCCGAGGCCCACTTCGATGAGTACGAGCACT
ACAACTTCGACCATGACAAGCACATCTTCTCTGGACACAGCGGCAAGCAG
CGCAACAAGAGGGAGGCCAATGAGCACACCAACCACTTCGATCCCTCCGG
TCATTCCCGCAAGATTCTGACCAAGCTGATGAACACCAACAACAACAACA
AGAAAGCCGCCGCCTGCAAGAACGCAAGCTTTCTAGACCAT
BO28701.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6770-RA | 210 | CG6770-PA | 1..207 | 17..223 | 1035 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6770-RA | 776 | CG6770-RA | 144..350 | 17..223 | 1035 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 12045769..12045975 | 223..17 | 1035 | 100 | Minus |
Blast to na_te.dros performed 2014-11-27 06:36:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2386..2436 | 182..229 | 103 | 72.5 | Plus |
BO28701.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:22 Download gff for
BO28701.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6770-RA | 126..332 | 17..225 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:00 Download gff for
BO28701.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6770-RA | 144..350 | 17..225 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:22 Download gff for
BO28701.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6770-RA | 144..350 | 17..225 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:22 Download gff for
BO28701.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12045766..12045975 | 17..225 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:00 Download gff for
BO28701.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 12045766..12045975 | 17..225 | 99 | | Minus |
BO28701.pep Sequence
Translation from 16 to 241
> BO28701.pep
MSEAHFDEYEHYNFDHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRKI
LTKLMNTNNNNKKAAACKNASFLDH
BO28701.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6770-PA | 69 | CG6770-PA | 1..69 | 1..69 | 386 | 100 | Plus |