Clone BO28701 Report

Search the DGRC for BO28701

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG6770-RA
Protein status:BO28701.pep: Imported from assembly
Sequenced Size:241

Clone Sequence Records

BO28701.complete Sequence

241 bp assembled on 2011-08-24

GenBank Submission: KX794235

> BO28701.complete
GAAGTTATCAGTCGACATGTCCGAGGCCCACTTCGATGAGTACGAGCACT
ACAACTTCGACCATGACAAGCACATCTTCTCTGGACACAGCGGCAAGCAG
CGCAACAAGAGGGAGGCCAATGAGCACACCAACCACTTCGATCCCTCCGG
TCATTCCCGCAAGATTCTGACCAAGCTGATGAACACCAACAACAACAACA
AGAAAGCCGCCGCCTGCAAGAACGCAAGCTTTCTAGACCAT

BO28701.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-RA 210 CG6770-PA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-RA 776 CG6770-RA 144..350 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12045769..12045975 223..17 1035 100 Minus
Blast to na_te.dros performed 2014-11-27 06:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2386..2436 182..229 103 72.5 Plus

BO28701.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:22 Download gff for BO28701.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 126..332 17..225 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:00 Download gff for BO28701.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 144..350 17..225 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:22 Download gff for BO28701.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 144..350 17..225 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:22 Download gff for BO28701.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12045766..12045975 17..225 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:00 Download gff for BO28701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12045766..12045975 17..225 99   Minus

BO28701.pep Sequence

Translation from 16 to 241

> BO28701.pep
MSEAHFDEYEHYNFDHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRKI
LTKLMNTNNNNKKAAACKNASFLDH

BO28701.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-PA 69 CG6770-PA 1..69 1..69 386 100 Plus