Clone BO28711 Report

Search the DGRC for BO28711

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptUcrh-RB
Protein status:BO28711.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO28711.complete Sequence

289 bp assembled on 2011-08-24

GenBank Submission: KX799543

> BO28711.complete
GAAGTTATCAGTCGACATGGCTTTTAGGAACTGGTTTTCGCTTCCCGCCG
TCAGAGCTGATGACGAAGAGGACTTAGTTGACCCTCAAGCAGTTTTAAGG
GAAAAATGTCAAGCTAAAGGTCACATAGAATCCTTGTACAATAAGTACCA
AGAGTGCAATGATCGTGTTAATGGGCGATCCAAAACAACTGAGACTTGCA
TCGAAGAATTATTTGACTATGTTGCTGAGTTAGATCATTGCGTTTCGCAC
AGTCTTTTTACAAAGCTTAAGGCAAGCTTTCTAGACCAT

BO28711.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ucrh-RD 258 CG41623-PD 1..255 17..271 1275 100 Plus
Ucrh-RC 258 CG41623-PC 1..255 17..271 1275 100 Plus
Ucrh-RB 258 CG41623-PB 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Ucrh-RD 506 CG41623-RD 95..349 17..271 1275 100 Plus
Ucrh-RC 434 CG41623-RC 97..351 17..271 1275 100 Plus
Ucrh-RB 416 CG41623-RB 79..333 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 25121043..25121214 100..271 860 100 Plus
3L 28110227 3L 25120902..25120991 17..106 435 98.9 Plus
2R 25286936 2R 8677379..8677576 58..255 435 81.3 Plus
Blast to na_te.dros performed on 2014-11-27 06:35:28 has no hits.

BO28711.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:21 Download gff for BO28711.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RD 102..356 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:35 Download gff for BO28711.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 79..333 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:03 Download gff for BO28711.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 79..333 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:03 Download gff for BO28711.complete
Subject Subject Range Query Range Percent Splice Strand
3L 25120902..25120985 17..100 100 -> Plus
3L 25121044..25121214 101..273 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:35 Download gff for BO28711.complete
Subject Subject Range Query Range Percent Splice Strand
3LHet 606358..606441 17..100 100 -> Plus
3LHet 606500..606670 101..273 98   Plus

BO28711.pep Sequence

Translation from 16 to 289

> BO28711.pep
MAFRNWFSLPAVRADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDR
VNGRSKTTETCIEELFDYVAELDHCVSHSLFTKLKASFLDH

BO28711.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Ucrh-PD 85 CG41623-PD 1..85 1..85 456 100 Plus
Ucrh-PC 85 CG41623-PC 1..85 1..85 456 100 Plus
Ucrh-PB 85 CG41623-PB 1..85 1..85 456 100 Plus
CG30354-PB 86 CG30354-PB 1..86 1..85 360 77.9 Plus
CG30354-PA 86 CG30354-PA 1..86 1..85 360 77.9 Plus