Clone BO28713 Report

Search the DGRC for BO28713

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:13
Vector:pDNR-Dual
Associated Gene/Transcriptmtacp1-RA
Protein status:BO28713.pep: Imported from assembly
Sequenced Size:491

Clone Sequence Records

BO28713.complete Sequence

491 bp assembled on 2011-08-24

> BO28713.complete
GAAGTTATCAGTCGACATGTCGTTCACACAGATCGCGCGCAGCTGCAGTC
GACTGGCGGCCACTTTGGCCCCAAGGAGGGTCGCCTCCGGCATTCTCATC
CAATCACAGGCCTCCAGGATGATGCACAGGATCGCCGTGCCATCGATGAC
CAGCCAGTTGAGCCAAGAGTGCCGTGGTCGCTGGCAAACGCAATTGGTGC
GCAGATACTCGGCGAAACCGCCGCTCTCGCTGAAGCTGATCAATGAGCGC
GTCTTGCTTGTGCTCAAGCTCTACGACAAGATCGATCCCAGCAAGCTCAA
CGTTGAGTCGCACTTCATCAACGACTTGGGACTGGATTCCTTGGACCACG
TGGAGGTCATCATGGCCATGGAGGACGAGTTCGGTTTCGAGATCCCCGAC
TCTGATGCCGAGAAGCTGCTTAAACCTGCCGACATTATTAAGTACGTCGC
CGACAAGGAGGATGTGTACGAGGCGAAGCTTTCTAGACCAT

BO28713.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-RA 459 CG9160-PA 1..456 17..472 2280 100 Plus
mtacp1-RC 546 CG9160-PC 236..543 165..472 1540 100 Plus
mtacp1-RB 432 CG9160-PB 250..429 293..472 900 100 Plus
mtacp1-RC 546 CG9160-PC 1..154 17..170 755 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-RA 740 CG9160-RA 106..565 13..472 2285 99.8 Plus
mtacp1-RC 739 CG9160-RC 345..652 165..472 1540 100 Plus
mtacp1-RB 625 CG9160-RB 359..538 293..472 900 100 Plus
mtacp1-RC 739 CG9160-RC 106..263 13..170 760 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1331278..1331456 294..472 895 100 Plus
3L 28110227 3L 1330137..1330291 13..167 760 99.4 Plus
3L 28110227 3L 1331038..1331177 163..302 655 97.9 Plus
Blast to na_te.dros performed 2014-11-27 06:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 3462..3553 371..462 117 61.3 Plus

BO28713.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:26 Download gff for BO28713.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 253..708 17..475 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:59 Download gff for BO28713.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 110..565 17..475 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:10 Download gff for BO28713.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RA 110..565 17..475 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:10 Download gff for BO28713.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1331280..1331456 296..475 98   Plus
3L 1330141..1330290 17..166 100 -> Plus
3L 1331042..1331170 167..295 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:59 Download gff for BO28713.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1331042..1331170 167..295 100 -> Plus
arm_3L 1330141..1330290 17..166 100 -> Plus
arm_3L 1331280..1331456 296..475 98   Plus

BO28713.pep Sequence

Translation from 16 to 490

> BO28713.pep
MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQ
ECRGRWQTQLVRRYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHF
INDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDV
YEAKLSRP

BO28713.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-PA 152 CG9160-PA 1..152 1..152 761 100 Plus
mtacp1-PC 181 CG9160-PC 1..181 1..152 721 84 Plus
mtacp1-PB 143 CG9160-PB 1..143 1..152 572 81.6 Plus