Clone BO28714 Report

Search the DGRC for BO28714

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:14
Vector:pDNR-Dual
Associated Gene/Transcripthoip-RA
Protein status:BO28714.pep: Imported from assembly
Sequenced Size:415

Clone Sequence Records

BO28714.complete Sequence

415 bp assembled on 2011-08-24

GenBank Submission: KX795554

> BO28714.complete
GAAGTTATCAGTCGACATGACTGAGGAAGTTAATCCCAAGGCATTCCCGC
TGGCCGATGCCCAGCTTACCGCCAAGATCATGAACTTGCTGCAGCAAGCA
TTGAACTACAATCAACTGCGCAAGGGAGCCAACGAGGCCACCAAGACCCT
CAATCGCGGACTGGCCGATATTGTGGTGCTGGCCGGTGATGCGGAGCCCA
TCGAGATTCTGCTCCATTTGCCGCTCCTGTGCGAGGACAAGAACGTGCCC
TACGTCTTCGTTCGTTCCAAGCAGGCCTTGGGGCGTGCGTGCGGAGTTTC
CCGGCCAATAGTCGCCTGCTCTGTGACCACCAACGAGGGCAGCCAGCTCA
AGTCGCAGATCACCTCCATTCAGCAGGAGATCGAGCGACTGCTAGTCGCA
AGCTTTCTAGACCAT

BO28714.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-RB 384 CG3949-PB 1..381 17..397 1905 100 Plus
hoip-RA 384 CG3949-PA 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-RB 607 CG3949-RB 145..525 17..397 1905 100 Plus
hoip-RA 569 CG3949-RA 107..487 17..397 1905 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9699999..9700377 19..397 1895 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:38:03 has no hits.

BO28714.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:26 Download gff for BO28714.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 145..525 17..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:05 Download gff for BO28714.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 107..487 17..399 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:15 Download gff for BO28714.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 107..487 17..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:15 Download gff for BO28714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9699998..9700377 17..399 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:05 Download gff for BO28714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9699998..9700377 17..399 99   Plus

BO28714.pep Sequence

Translation from 16 to 415

> BO28714.pep
MTEEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLA
DIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVA
CSVTTNEGSQLKSQITSIQQEIERLLVASFLDH

BO28714.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-PB 127 CG3949-PB 1..127 1..127 631 100 Plus
hoip-PA 127 CG3949-PA 1..127 1..127 631 100 Plus
NHP2-PB 160 CG5258-PB 37..156 5..125 194 35.2 Plus
NHP2-PA 160 CG5258-PA 37..156 5..125 194 35.2 Plus