Clone BO28741 Report

Search the DGRC for BO28741

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptTrx-2-RA
Protein status:BO28741.pep: Imported from assembly
Sequenced Size:352

Clone Sequence Records

BO28741.complete Sequence

352 bp assembled on 2011-08-24

GenBank Submission: KX799778

> BO28741.complete
GAAGTTATCAGTCGACATGGTGTACCAGGTGAAAGATAAGGCCGATCTCG
ATGGACAGCTGACCAAGGCATCCGGCAAGCTGGTGGTGCTGGATTTCTTC
GCCACTTGGTGCGGACCCTGCAAGATGATCTCGCCCAAACTGGTTGAGCT
TTCCACGCAGTTCGCCGACAACGTCGTCGTCCTGAAGGTCGATGTGGACG
AATGCGAAGACATTGCAATGGAATACAACATCTCCAGCATGCCCACCTTC
GTGTTCCTCAAGAACGGCGTCAAGGTCGAAGAGTTCGCCGGAGCCAACGC
CAAGCGTCTGGAGGATGTCATCAAGGCCAATATCGCAAGCTTTCTAGACC
AT

BO28741.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 321 CG31884-PA 1..318 17..334 1590 100 Plus
Trx-2-RB 321 CG31884-PB 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 790 CG31884-RA 102..421 15..334 1600 100 Plus
Trx-2-RB 1338 CG31884-RB 293..612 15..334 1600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9615300..9615450 39..189 755 100 Plus
2L 23513712 2L 9615530..9615678 186..334 745 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:43:43 has no hits.

BO28741.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:36 Download gff for BO28741.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 296..613 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:04 Download gff for BO28741.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 295..612 17..336 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:45 Download gff for BO28741.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 295..612 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:45 Download gff for BO28741.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9613517..9613540 17..40 100 -> Plus
2L 9615302..9615448 41..187 100 -> Plus
2L 9615532..9615678 188..336 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:04 Download gff for BO28741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9613517..9613540 17..40 100 -> Plus
arm_2L 9615302..9615448 41..187 100 -> Plus
arm_2L 9615532..9615678 188..336 98   Plus

BO28741.pep Sequence

Translation from 16 to 352

> BO28741.pep
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA
DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLED
VIKANIASFLDH

BO28741.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-PA 106 CG31884-PA 1..106 1..106 541 100 Plus
Trx-2-PB 106 CG31884-PB 1..106 1..106 541 100 Plus
TrxT-PB 157 CG3315-PB 1..111 1..111 329 55.9 Plus
TrxT-PA 157 CG3315-PA 1..111 1..111 329 55.9 Plus
CG13473-PA 139 CG13473-PA 26..118 19..111 240 43 Plus