BO28741.complete Sequence
352 bp assembled on 2011-08-24
GenBank Submission: KX799778
> BO28741.complete
GAAGTTATCAGTCGACATGGTGTACCAGGTGAAAGATAAGGCCGATCTCG
ATGGACAGCTGACCAAGGCATCCGGCAAGCTGGTGGTGCTGGATTTCTTC
GCCACTTGGTGCGGACCCTGCAAGATGATCTCGCCCAAACTGGTTGAGCT
TTCCACGCAGTTCGCCGACAACGTCGTCGTCCTGAAGGTCGATGTGGACG
AATGCGAAGACATTGCAATGGAATACAACATCTCCAGCATGCCCACCTTC
GTGTTCCTCAAGAACGGCGTCAAGGTCGAAGAGTTCGCCGGAGCCAACGC
CAAGCGTCTGGAGGATGTCATCAAGGCCAATATCGCAAGCTTTCTAGACC
AT
BO28741.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:43:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Trx-2-RA | 321 | CG31884-PA | 1..318 | 17..334 | 1590 | 100 | Plus |
Trx-2-RB | 321 | CG31884-PB | 1..318 | 17..334 | 1590 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:43:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Trx-2-RA | 790 | CG31884-RA | 102..421 | 15..334 | 1600 | 100 | Plus |
Trx-2-RB | 1338 | CG31884-RB | 293..612 | 15..334 | 1600 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:43:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9615300..9615450 | 39..189 | 755 | 100 | Plus |
2L | 23513712 | 2L | 9615530..9615678 | 186..334 | 745 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 06:43:43 has no hits.
BO28741.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:36 Download gff for
BO28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Trx-2-RB | 296..613 | 17..336 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:04 Download gff for
BO28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Trx-2-RB | 295..612 | 17..336 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:45 Download gff for
BO28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Trx-2-RB | 295..612 | 17..336 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:45 Download gff for
BO28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9613517..9613540 | 17..40 | 100 | -> | Plus |
2L | 9615302..9615448 | 41..187 | 100 | -> | Plus |
2L | 9615532..9615678 | 188..336 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:04 Download gff for
BO28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9613517..9613540 | 17..40 | 100 | -> | Plus |
arm_2L | 9615302..9615448 | 41..187 | 100 | -> | Plus |
arm_2L | 9615532..9615678 | 188..336 | 98 | | Plus |
BO28741.pep Sequence
Translation from 16 to 352
> BO28741.pep
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA
DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLED
VIKANIASFLDH
BO28741.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Trx-2-PA | 106 | CG31884-PA | 1..106 | 1..106 | 541 | 100 | Plus |
Trx-2-PB | 106 | CG31884-PB | 1..106 | 1..106 | 541 | 100 | Plus |
TrxT-PB | 157 | CG3315-PB | 1..111 | 1..111 | 329 | 55.9 | Plus |
TrxT-PA | 157 | CG3315-PA | 1..111 | 1..111 | 329 | 55.9 | Plus |
CG13473-PA | 139 | CG13473-PA | 26..118 | 19..111 | 240 | 43 | Plus |