Clone BO28747 Report

Search the DGRC for BO28747

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG12607-RC
Protein status:BO28747.pep: Imported from assembly
Sequenced Size:478

Clone Sequence Records

BO28747.complete Sequence

478 bp assembled on 2011-08-24

GenBank Submission: KX796608

> BO28747.complete
GAAGTTATCAGTCGACATGAAATTCTTTTTGCTATTGGCTTTGGCCCTTG
TGGGCATTGCTGCTGGAGCTCAGCTTCCTGACTCCGCCACCCAGGGACCC
AATCCTCAGGATATTGCCACCCCGGAGCCGGAGTACATTGATATCGACGA
ACCTGCACCGGTGGCTGCCGCACCTGCTCCTCGTCCTGTGGCCGCTGCTC
CCCGTCCCGTCTTCGCCGCCCCTGCTCCCATCGCTCGGCCAGTTGCTCAT
CCAGTGGCTCGCCCCGTGGTTGTGGCCCAATCCTTCGTCCAGCAGCCCGT
CCAGCAGCAGATTGTCCAGAGGGCTCAGTACGTGGCGCCGGTGGCTCAGC
AGGTGGTGTTGCCGCAACAGCAGCTGGTGGGACACACCTACAACAGCAGG
GCTGGATACCAGTACCGCCGTCCAGTCTATGTAAGACGTTTCTATCGCCT
GCGCCGCTACGCAAGCTTTCTAGACCAT

BO28747.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-RC 447 CG12607-PC 1..444 17..460 2220 100 Plus
CG12607-RD 420 CG12607-PD 1..414 17..430 2070 100 Plus
CG12607-RB 468 CG12607-PB 1..414 17..430 2070 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-RC 1001 CG12607-RC 103..546 17..460 2220 100 Plus
CG12607-RD 794 CG12607-RD 103..516 17..430 2070 100 Plus
CG12607-RB 691 CG12607-RB 103..516 17..430 2070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4447176..4447617 19..460 2210 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:42:19 has no hits.

BO28747.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:32 Download gff for BO28747.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 101..544 17..462 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:20 Download gff for BO28747.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 103..546 17..462 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:11 Download gff for BO28747.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 103..546 17..462 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:11 Download gff for BO28747.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4447175..4447617 17..462 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:20 Download gff for BO28747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4447175..4447617 17..462 99   Plus

BO28747.pep Sequence

Translation from 16 to 478

> BO28747.pep
MKFFLLLALALVGIAAGAQLPDSATQGPNPQDIATPEPEYIDIDEPAPVA
AAPAPRPVAAAPRPVFAAPAPIARPVAHPVARPVVVAQSFVQQPVQQQIV
QRAQYVAPVAQQVVLPQQQLVGHTYNSRAGYQYRRPVYVRRFYRLRRYAS
FLDH

BO28747.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-PC 148 CG12607-PC 1..148 1..148 757 100 Plus
CG12607-PD 139 CG12607-PD 1..138 1..138 704 100 Plus
CG12607-PB 155 CG12607-PB 1..138 1..138 704 100 Plus