Clone BO28783 Report

Search the DGRC for BO28783

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG34331-RB
Protein status:BO28783.pep: Imported from assembly
Sequenced Size:367

Clone Sequence Records

BO28783.complete Sequence

367 bp assembled on 2011-08-24

GenBank Submission: KX796568

> BO28783.complete
GAAGTTATCAGTCGACATGAGCGCAATAAAGCCCGCCCTGCTGCTCTGCC
TGATCCTCACCATCGGTCTGTTCCTTGGTCAAGGTCGGGCGAATCCCGTG
GAGACGAATGTTCCCGATATTCCCGCACCCGATGCCAACGAACTGGGCAT
CGATTTCGGAGAGGAGGAAGATGCCACCGACAAGCCACTGGGCATATTCA
CGATCAAGGTGCGCCACATTCAGCCGGACCCCGCCCACTGCGCCCAGCTC
TCGCCACATCACCCACACCACCCCCAGTGCCACAGCTACTGCAAACGCCA
AGGTCACTGGGTGGGCCAGTGCAAGAAGGACATCTGTCAGTGCTTTTCCG
CAAGCTTTCTAGACCAT

BO28783.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 336 CG34331-PB 1..333 17..349 1665 100 Plus
CG34331-RC 405 CG34331-PC 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 609 CG34331-RB 28..364 13..349 1670 99.7 Plus
CG34331-RC 599 CG34331-RC 28..223 13..208 965 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20122480..20122816 13..349 1670 99.7 Plus
Blast to na_te.dros performed on 2014-11-27 07:17:28 has no hits.

BO28783.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:15 Download gff for BO28783.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 28..360 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:06 Download gff for BO28783.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 32..364 17..351 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:37 Download gff for BO28783.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 32..364 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:37 Download gff for BO28783.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122484..20122816 17..351 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:06 Download gff for BO28783.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20016517..20016849 17..351 99   Plus

BO28783.pep Sequence

Translation from 16 to 367

> BO28783.pep
MSAIKPALLLCLILTIGLFLGQGRANPVETNVPDIPAPDANELGIDFGEE
EDATDKPLGIFTIKVRHIQPDPAHCAQLSPHHPHHPQCHSYCKRQGHWVG
QCKKDICQCFSASFLDH

BO28783.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-PB 111 CG34331-PB 1..111 1..111 624 100 Plus
CG34331-PC 134 CG34331-PC 1..69 1..69 332 95.7 Plus