BO28806.complete Sequence
229 bp assembled on 2012-04-24
GenBank Submission: KX794754
> BO28806.complete
GAAGTTATCAGTCGACATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCG
GCAACGGCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTT
GGCAAAATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAA
GGAGCAACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGG
CTCCCAAGAAGGCAAGCTTTCTAGACCAT
BO28806.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:21:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34423-RB | 258 | CG34423-PB | 61..255 | 17..211 | 975 | 100 | Plus |
CG34423-RA | 198 | CG34423-PA | 1..195 | 17..211 | 975 | 100 | Plus |
CG13551-RB | 324 | CG13551-PB | 88..210 | 38..160 | 315 | 83.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:21:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34423-RB | 468 | CG34423-RB | 167..361 | 17..211 | 975 | 100 | Plus |
CG34423-RA | 406 | CG34423-RA | 105..299 | 17..211 | 975 | 100 | Plus |
CG13551-RB | 637 | CG13551-RB | 218..340 | 38..160 | 315 | 83.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:21:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23358843..23358971 | 17..145 | 645 | 100 | Plus |
2R | 25286936 | 2R | 23359028..23359097 | 142..211 | 350 | 100 | Plus |
2R | 25286936 | 2R | 23382618..23382722 | 142..38 | 270 | 83.8 | Minus |
Blast to na_te.dros performed on 2014-11-28 08:21:36 has no hits.
BO28806.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:02:05 Download gff for
BO28806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34423-RB | 61..255 | 17..213 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:23 Download gff for
BO28806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34423-RA | 105..299 | 17..213 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:16:18 Download gff for
BO28806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34423-RA | 105..299 | 17..213 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:16:18 Download gff for
BO28806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23358843..23358971 | 17..145 | 100 | -> | Plus |
2R | 23359032..23359097 | 146..213 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:23 Download gff for
BO28806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19246366..19246494 | 17..145 | 100 | -> | Plus |
arm_2R | 19246555..19246620 | 146..213 | 97 | | Plus |
BO28806.pep Sequence
Translation from 16 to 229
> BO28806.pep
MSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREEEFFYKQQKEQLKN
LKTKTEPKAPEAPKKASFLDH
BO28806.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34423-PA | 65 | CG34423-PA | 1..65 | 1..65 | 336 | 100 | Plus |
CG34423-PB | 85 | CG34423-PB | 21..85 | 1..65 | 336 | 100 | Plus |
CG13551-PB | 107 | CG13551-PB | 24..74 | 2..52 | 224 | 80.4 | Plus |
CG13551-PA | 107 | CG13551-PA | 24..74 | 2..52 | 224 | 80.4 | Plus |