Clone BO28806 Report

Search the DGRC for BO28806

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG34423-RA
Protein status:BO28806.pep: Imported from assembly
Sequenced Size:229

Clone Sequence Records

BO28806.complete Sequence

229 bp assembled on 2012-04-24

GenBank Submission: KX794754

> BO28806.complete
GAAGTTATCAGTCGACATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCG
GCAACGGCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTT
GGCAAAATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAA
GGAGCAACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGG
CTCCCAAGAAGGCAAGCTTTCTAGACCAT

BO28806.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34423-RB 258 CG34423-PB 61..255 17..211 975 100 Plus
CG34423-RA 198 CG34423-PA 1..195 17..211 975 100 Plus
CG13551-RB 324 CG13551-PB 88..210 38..160 315 83.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34423-RB 468 CG34423-RB 167..361 17..211 975 100 Plus
CG34423-RA 406 CG34423-RA 105..299 17..211 975 100 Plus
CG13551-RB 637 CG13551-RB 218..340 38..160 315 83.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23358843..23358971 17..145 645 100 Plus
2R 25286936 2R 23359028..23359097 142..211 350 100 Plus
2R 25286936 2R 23382618..23382722 142..38 270 83.8 Minus
Blast to na_te.dros performed on 2014-11-28 08:21:36 has no hits.

BO28806.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:02:05 Download gff for BO28806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 61..255 17..213 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:23 Download gff for BO28806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RA 105..299 17..213 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:16:18 Download gff for BO28806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RA 105..299 17..213 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:16:18 Download gff for BO28806.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23358843..23358971 17..145 100 -> Plus
2R 23359032..23359097 146..213 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:23 Download gff for BO28806.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19246366..19246494 17..145 100 -> Plus
arm_2R 19246555..19246620 146..213 97   Plus

BO28806.pep Sequence

Translation from 16 to 229

> BO28806.pep
MSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREEEFFYKQQKEQLKN
LKTKTEPKAPEAPKKASFLDH

BO28806.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34423-PA 65 CG34423-PA 1..65 1..65 336 100 Plus
CG34423-PB 85 CG34423-PB 21..85 1..65 336 100 Plus
CG13551-PB 107 CG13551-PB 24..74 2..52 224 80.4 Plus
CG13551-PA 107 CG13551-PA 24..74 2..52 224 80.4 Plus