BO28921.complete Sequence
292 bp assembled on 2011-08-24
GenBank Submission: KX793879
> BO28921.complete
GAAGTTATCAGTCGACATGGAGCAGCTATTTCAGAATTACCGCGACGATG
AGCGAAGGATCGGCGAGGAGTATCTGTCAAGTCTCCAGGACCTCAACTGC
AACAGCAAGCCATTGATCAATATGCTCACGATGCTTGCCGAGGAGAACAT
CAACTACGCCCACATCATAGTTAAAGTGGTGGAATATTACATCAGCCAGG
TTAACAAAACAAAAGCGTATTTACTTAAAAACAAAGACACTCCAGCTTAC
ACACAGCTAATAGACGGTCGACACGCAAGCTTTCTAGACCAT
BO28921.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:09:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Inr-a-RC | 261 | CG10228-PC | 1..258 | 17..274 | 1290 | 100 | Plus |
| Inr-a-RH | 5520 | CG10228-PH | 1..185 | 17..201 | 925 | 100 | Plus |
| Inr-a-RE | 5520 | CG10228-PE | 1..185 | 17..201 | 925 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Inr-a-RC | 819 | CG10228-RC | 234..491 | 17..274 | 1290 | 100 | Plus |
| Inr-a-RH | 6199 | CG86-RH | 234..418 | 17..201 | 925 | 100 | Plus |
| Inr-a-RE | 5979 | CG10228-RE | 234..418 | 17..201 | 925 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 14869974..14870231 | 274..17 | 1290 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:09:30 has no hits.
BO28921.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:59 Download gff for
BO28921.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Pcf11-RC | 233..490 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:37 Download gff for
BO28921.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Inr-a-RC | 234..491 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:30 Download gff for
BO28921.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Inr-a-RC | 234..491 | 17..276 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:12:30 Download gff for
BO28921.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 14869972..14870231 | 17..276 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:37 Download gff for
BO28921.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 10757477..10757736 | 17..276 | 99 | | Minus |
BO28921.pep Sequence
Translation from 16 to 292
> BO28921.pep
MEQLFQNYRDDERRIGEEYLSSLQDLNCNSKPLINMLTMLAEENINYAHI
IVKVVEYYISQVNKTKAYLLKNKDTPAYTQLIDGRHASFLDH
BO28921.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Inr-a-PC | 86 | CG10228-PC | 1..86 | 1..86 | 445 | 100 | Plus |
| Inr-a-PB | 573 | CG10228-PB | 1..62 | 1..62 | 317 | 100 | Plus |
| Inr-a-PH | 1839 | CG10228-PH | 1..62 | 1..62 | 317 | 100 | Plus |
| Inr-a-PE | 1839 | CG10228-PE | 1..62 | 1..62 | 317 | 100 | Plus |
| Inr-a-PF | 1850 | CG10228-PF | 1..62 | 1..62 | 317 | 100 | Plus |
