Clone BO28923 Report

Search the DGRC for BO28923

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG42847-RA
Protein status:BO28923.pep: Imported from assembly
Sequenced Size:457

Clone Sequence Records

BO28923.complete Sequence

457 bp assembled on 2011-08-24

GenBank Submission: KX796525

> BO28923.complete
GAAGTTATCAGTCGACATGTCGAATTATAGGGTTACATATAAAAATCGAT
GCATTAGCTGTGGCGTCGAAGTACCAGTCCTTTCCACAAATGGATGCCAT
TTCAAAGTTCAGGACAAATTTAATTCTTGTGGCTCCAAAATAAGCAATCC
TCGAAAACGGCCGAGTCAAATAAAAAGGCACAGGAATATTTCTCAAAGAA
AGCTAAATAATGGTTTTAAATGGTCTTCATCATCTACGAAAAAACGATTC
TATCCGTTAGTAAAGAAACAAAAATTGTTGATGTCCTCAGAGCCCTCTCA
TAAGGCTCTAATTTTAAGAGAGATGATTAGGTTAGGAAGAAAACCGAATC
GAAAGTTCGAAAAGGCTGCGAGAAATAGTGTATTTCCGGGCATCTGCCGT
ACGATATTGAAACTGCACCAGTATACTAATCTTGTACAGGCAAGCTTTCT
AGACCAT

BO28923.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-RA 426 CG42847-PA 1..423 17..439 2115 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-RA 817 CG42847-RA 153..576 16..439 2120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9428022..9428396 16..390 1875 100 Plus
2L 23513712 2L 9428449..9428499 389..439 255 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:58:36 has no hits.

BO28923.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:55 Download gff for BO28923.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 112..534 17..441 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:02 Download gff for BO28923.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 154..576 17..441 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:59:36 Download gff for BO28923.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 154..576 17..441 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:59:36 Download gff for BO28923.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9428023..9428395 17..389 100 -> Plus
2L 9428450..9428499 390..441 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:02 Download gff for BO28923.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9428023..9428395 17..389 100 -> Plus
arm_2L 9428450..9428499 390..441 96   Plus

BO28923.pep Sequence

Translation from 16 to 457

> BO28923.pep
MSNYRVTYKNRCISCGVEVPVLSTNGCHFKVQDKFNSCGSKISNPRKRPS
QIKRHRNISQRKLNNGFKWSSSSTKKRFYPLVKKQKLLMSSEPSHKALIL
REMIRLGRKPNRKFEKAARNSVFPGICRTILKLHQYTNLVQASFLDH

BO28923.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-PA 141 CG42847-PA 1..141 1..141 743 100 Plus