Clone BO28924 Report

Search the DGRC for BO28924

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG42855-RB
Protein status:BO28924.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO28924.complete Sequence

262 bp assembled on 2011-08-24

GenBank Submission: KX794448

> BO28924.complete
GAAGTTATCAGTCGACATGGTCTCCTTTGGCGGTGTGGCAAAACTATTGA
GCAGCTTCGAGTGCTGTGCCAGTTCGTGGGTCAAAGCCGTAAATCCCGGA
TGGTACGAGGCTCGTGAGATTCCGAAGACCATCCTGATCCAGAAAGTGCG
ACAGGTGCCCCAGAATACCAGGGTGATACGCCAGAGACCCCAAACCGCGG
AGCCGCCCAAAAAATCCTCCAGCCAAAAGCGCCAACTTTATCTCGCAAGC
TTTCTAGACCAT

BO28924.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-RB 231 CG42855-PB 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-RB 945 CG42855-RB 78..305 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18687449..18687676 17..244 1140 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:07:37 has no hits.

BO28924.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:56 Download gff for BO28924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 78..305 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:52:56 Download gff for BO28924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 78..305 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:11:48 Download gff for BO28924.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 78..305 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:11:48 Download gff for BO28924.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18687449..18687676 17..246 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:52:56 Download gff for BO28924.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14574954..14575181 17..246 99   Plus

BO28924.pep Sequence

Translation from 16 to 262

> BO28924.pep
MVSFGGVAKLLSSFECCASSWVKAVNPGWYEAREIPKTILIQKVRQVPQN
TRVIRQRPQTAEPPKKSSSQKRQLYLASFLDH

BO28924.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-PB 76 CG42855-PB 1..76 1..76 394 100 Plus