BO28933.complete Sequence
391 bp assembled on 2011-08-24
GenBank Submission: KX798812
> BO28933.complete
GAAGTTATCAGTCGACATGGGCTGTTCTCCGAGTACTTTGCCCCCCGCCC
CTTCCGCTGGTCAGACCGGCGAACGAGGATCCCTGCCGCTGGACGCCTCT
GAAAAGGACGAGAGCCGCCTCTTCTGCATCAAGCTGCGGCGCAGCCGCCT
GCGCCGCTGCAGCTGTGGGGGCGTGACCTTGCAGCCCCCCAGCGACGGGA
ATGGCAGCACGGCCGGAGACAACCTGTGCGGCCAGGTGCTCCTCAATCCG
CTGCAGACCAAGAGCGAGGCCGACTACGAAAAGCTGAGCACCGGCAAAAA
GGACTCGATTGTGACGGTGGCCGCCCTGGGCAACTTTACACACAGCGTAG
TGCGACGGGCCACTGGAAGTAAGGCAAGCTTTCTAGACCAT
BO28933.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:16:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pde8-RK | 2745 | CG45019-PK | 1..353 | 17..369 | 1765 | 100 | Plus |
Pde8-RI | 2745 | CG45019-PI | 1..353 | 17..369 | 1765 | 100 | Plus |
Pde8-RN | 2850 | CG45019-PN | 1..353 | 17..369 | 1765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:16:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pde8-RK | 5389 | CG45019-RK | 489..842 | 16..369 | 1770 | 100 | Plus |
Pde8-RI | 5562 | CG45019-RI | 662..1015 | 16..369 | 1770 | 100 | Plus |
Pde8-RN | 3939 | CG45019-RN | 775..1128 | 16..369 | 1770 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:16:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23665620..23665887 | 16..283 | 1340 | 100 | Plus |
2R | 25286936 | 2R | 23665949..23666040 | 282..373 | 460 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 16:16:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\ninja | 6644 | Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). | 2149..2217 | 107..176 | 113 | 64.3 | Plus |
BO28933.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:06 Download gff for
BO28933.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pde8-RF | 638..994 | 17..375 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:34 Download gff for
BO28933.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pde8-RN | 776..1135 | 17..375 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:12 Download gff for
BO28933.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pde8-RN | 776..1135 | 17..375 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:12 Download gff for
BO28933.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23665951..23666040 | 284..375 | 97 | | Plus |
2R | 23665621..23665887 | 17..283 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:34 Download gff for
BO28933.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19553144..19553410 | 17..283 | 100 | -> | Plus |
arm_2R | 19553474..19553563 | 284..375 | 97 | | Plus |
BO28933.pep Sequence
Translation from 16 to 391
> BO28933.pep
MGCSPSTLPPAPSAGQTGERGSLPLDASEKDESRLFCIKLRRSRLRRCSC
GGVTLQPPSDGNGSTAGDNLCGQVLLNPLQTKSEADYEKLSTGKKDSIVT
VAALGNFTHSVVRRATGSKASFLDH
BO28933.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pde8-PE | 905 | CG45019-PE | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PK | 914 | CG45019-PK | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PI | 914 | CG45019-PI | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PA | 914 | CG45019-PA | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PN | 949 | CG45019-PN | 1..118 | 1..118 | 612 | 100 | Plus |