Clone BO28933 Report

Search the DGRC for BO28933

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptPde8-RF
Protein status:BO28933.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO28933.complete Sequence

391 bp assembled on 2011-08-24

GenBank Submission: KX798812

> BO28933.complete
GAAGTTATCAGTCGACATGGGCTGTTCTCCGAGTACTTTGCCCCCCGCCC
CTTCCGCTGGTCAGACCGGCGAACGAGGATCCCTGCCGCTGGACGCCTCT
GAAAAGGACGAGAGCCGCCTCTTCTGCATCAAGCTGCGGCGCAGCCGCCT
GCGCCGCTGCAGCTGTGGGGGCGTGACCTTGCAGCCCCCCAGCGACGGGA
ATGGCAGCACGGCCGGAGACAACCTGTGCGGCCAGGTGCTCCTCAATCCG
CTGCAGACCAAGAGCGAGGCCGACTACGAAAAGCTGAGCACCGGCAAAAA
GGACTCGATTGTGACGGTGGCCGCCCTGGGCAACTTTACACACAGCGTAG
TGCGACGGGCCACTGGAAGTAAGGCAAGCTTTCTAGACCAT

BO28933.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Pde8-RK 2745 CG45019-PK 1..353 17..369 1765 100 Plus
Pde8-RI 2745 CG45019-PI 1..353 17..369 1765 100 Plus
Pde8-RN 2850 CG45019-PN 1..353 17..369 1765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Pde8-RK 5389 CG45019-RK 489..842 16..369 1770 100 Plus
Pde8-RI 5562 CG45019-RI 662..1015 16..369 1770 100 Plus
Pde8-RN 3939 CG45019-RN 775..1128 16..369 1770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23665620..23665887 16..283 1340 100 Plus
2R 25286936 2R 23665949..23666040 282..373 460 100 Plus
Blast to na_te.dros performed 2014-11-26 16:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 2149..2217 107..176 113 64.3 Plus

BO28933.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:06 Download gff for BO28933.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RF 638..994 17..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:34 Download gff for BO28933.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RN 776..1135 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:12 Download gff for BO28933.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RN 776..1135 17..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:12 Download gff for BO28933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23665951..23666040 284..375 97   Plus
2R 23665621..23665887 17..283 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:34 Download gff for BO28933.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19553144..19553410 17..283 100 -> Plus
arm_2R 19553474..19553563 284..375 97   Plus

BO28933.pep Sequence

Translation from 16 to 391

> BO28933.pep
MGCSPSTLPPAPSAGQTGERGSLPLDASEKDESRLFCIKLRRSRLRRCSC
GGVTLQPPSDGNGSTAGDNLCGQVLLNPLQTKSEADYEKLSTGKKDSIVT
VAALGNFTHSVVRRATGSKASFLDH

BO28933.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Pde8-PE 905 CG45019-PE 1..118 1..118 612 100 Plus
Pde8-PK 914 CG45019-PK 1..118 1..118 612 100 Plus
Pde8-PI 914 CG45019-PI 1..118 1..118 612 100 Plus
Pde8-PA 914 CG45019-PA 1..118 1..118 612 100 Plus
Pde8-PN 949 CG45019-PN 1..118 1..118 612 100 Plus