Clone BO28937 Report

Search the DGRC for BO28937

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptSfp38D-RA
Protein status:BO28937.pep: Imported from assembly
Sequenced Size:541

Clone Sequence Records

BO28937.complete Sequence

541 bp assembled on 2011-08-24

GenBank Submission: KX797041

> BO28937.complete
GAAGTTATCAGTCGACATGAAGTTTATGGCAATATGCCTATTGGCAAATA
TTGGCTACATACTTGGCACTACAATTGGCCAGCTTAATGACGAAGCCACA
ATTCGACTAAAGGGACTTGTGGAGAAATATAAACTGCAAGCTCTTAGCAA
TCCCGAATTCTCTCAGTGGATTGGCAAACTTGAGAAAACTAGCAAGTCGA
GAAGATTGGAAGACAAAATGAAGGTCAAAGCTGAATTTAAAAACTACGAC
GAACGTCGCTTGCAATTGGAAAATAAAATTAGGGAACGCATTACGGCGAT
CGATGACCTCATATCCGATATTATGGCCAAAGTCCCGATAAAGGATAAAG
GGTGTCTCAAGTATTACCAACGCCAGAAAAGATCCCTTAAATTGGCCCAC
AATTTTTCGAATTTAACTAAGCAAACAAACCTCATACGCAACTCGAAACA
ATGCGAAACAACTAAAGTGCAGTCTAGTGAACTAAGTGAAAGCTCTGAAA
ATCCGGATGAGTATAGTTATTACGCAAGCTTTCTAGACCAT

BO28937.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-RB 510 CG42606-PB 1..507 17..523 2535 100 Plus
Sfp38D-RA 510 CG42606-PA 1..507 17..523 2535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-RB 1234 CG3-RB 24..530 17..523 2535 100 Plus
Sfp38D-RA 640 CG42606-RA 24..530 17..523 2535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20641049..20641512 60..523 2320 100 Plus
2L 23513712 2L 20640940..20640982 17..59 215 100 Plus
Blast to na_te.dros performed 2014-11-26 16:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 2095..2186 443..533 115 59.8 Plus
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 209..331 523..400 112 60.9 Minus

BO28937.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:08 Download gff for BO28937.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 24..530 17..525 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:59 Download gff for BO28937.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 24..530 17..525 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:37 Download gff for BO28937.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 24..530 17..525 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:37 Download gff for BO28937.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20640940..20640982 17..59 100 -> Plus
2L 20641049..20641512 60..525 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:59 Download gff for BO28937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20640940..20640982 17..59 100 -> Plus
arm_2L 20641049..20641512 60..525 99   Plus

BO28937.pep Sequence

Translation from 16 to 541

> BO28937.pep
MKFMAICLLANIGYILGTTIGQLNDEATIRLKGLVEKYKLQALSNPEFSQ
WIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDLIS
DIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCETTK
VQSSELSESSENPDEYSYYASFLDH

BO28937.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-PB 169 CG42606-PB 1..169 1..169 858 100 Plus
Sfp38D-PA 169 CG42606-PA 1..169 1..169 858 100 Plus
CG17472-PA 159 CG17472-PA 1..142 1..146 232 36.1 Plus
CG31680-PA 147 CG31680-PA 1..129 1..146 211 33.6 Plus