BO28939.complete Sequence
280 bp assembled on 2011-08-25
GenBank Submission: KX796265
> BO28939.complete
GAAGTTATCAGTCGACATGAAGTTACTCTGGCTGCTGTTAGTGGGCGTTG
TTGCCGGGCAACCTTGTGATAAGCTCTGTCCCATCAATAATAACTTCGGA
TGTGTCAGCAAGGACAATAAATGCTTTTACACCGTTCGCAATCCATGTAT
TTTGAAGGCCATTAACTGCTATCGTAAATCGAAGAACTTATCTGTTTTGA
AGCCCATTTTGCGCAGCAAGTGCACCAATAAGGAAGTTCCAGTTTGCGAG
AATATCAATAAAGCAAGCTTTCTAGACCAT
BO28939.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-RA | 249 | CG43056-PA | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-RA | 303 | CG43056-RA | 33..278 | 17..262 | 1230 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:55:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4437905..4438055 | 44..194 | 755 | 100 | Plus |
2L | 23513712 | 2L | 4438108..4438176 | 194..262 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 21:55:08 has no hits.
BO28939.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 14:44:52 Download gff for
BO28939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 33..278 | 17..264 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:46 Download gff for
BO28939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 33..278 | 17..264 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:51 Download gff for
BO28939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 33..278 | 17..264 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:51 Download gff for
BO28939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4437906..4438055 | 45..194 | 100 | -> | Plus |
2L | 4438109..4438176 | 195..264 | 97 | | Plus |
2L | 4437819..4437846 | 17..44 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:46 Download gff for
BO28939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4437819..4437846 | 17..44 | 100 | -> | Plus |
arm_2L | 4437906..4438055 | 45..194 | 100 | -> | Plus |
arm_2L | 4438109..4438176 | 195..264 | 97 | | Plus |
BO28939.pep Sequence
Translation from 16 to 280
> BO28939.pep
MKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTVRNPCILKAIN
CYRKSKNLSVLKPILRSKCTNKEVPVCENINKASFLDH
BO28939.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-PA | 82 | CG43056-PA | 1..82 | 1..82 | 450 | 100 | Plus |