Clone BO28939 Report

Search the DGRC for BO28939

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG43056-RA
Protein status:BO28939.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO28939.complete Sequence

280 bp assembled on 2011-08-25

GenBank Submission: KX796265

> BO28939.complete
GAAGTTATCAGTCGACATGAAGTTACTCTGGCTGCTGTTAGTGGGCGTTG
TTGCCGGGCAACCTTGTGATAAGCTCTGTCCCATCAATAATAACTTCGGA
TGTGTCAGCAAGGACAATAAATGCTTTTACACCGTTCGCAATCCATGTAT
TTTGAAGGCCATTAACTGCTATCGTAAATCGAAGAACTTATCTGTTTTGA
AGCCCATTTTGCGCAGCAAGTGCACCAATAAGGAAGTTCCAGTTTGCGAG
AATATCAATAAAGCAAGCTTTCTAGACCAT

BO28939.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-RA 249 CG43056-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-RA 303 CG43056-RA 33..278 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4437905..4438055 44..194 755 100 Plus
2L 23513712 2L 4438108..4438176 194..262 345 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:55:08 has no hits.

BO28939.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 14:44:52 Download gff for BO28939.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 33..278 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:46 Download gff for BO28939.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 33..278 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:51 Download gff for BO28939.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 33..278 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:51 Download gff for BO28939.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4437906..4438055 45..194 100 -> Plus
2L 4438109..4438176 195..264 97   Plus
2L 4437819..4437846 17..44 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:46 Download gff for BO28939.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4437819..4437846 17..44 100 -> Plus
arm_2L 4437906..4438055 45..194 100 -> Plus
arm_2L 4438109..4438176 195..264 97   Plus

BO28939.pep Sequence

Translation from 16 to 280

> BO28939.pep
MKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTVRNPCILKAIN
CYRKSKNLSVLKPILRSKCTNKEVPVCENINKASFLDH

BO28939.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-PA 82 CG43056-PA 1..82 1..82 450 100 Plus