Clone BO28944 Report

Search the DGRC for BO28944

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG42831-RA
Protein status:BO28944.pep: Imported from assembly
Sequenced Size:406

Clone Sequence Records

BO28944.complete Sequence

406 bp assembled on 2011-08-24

GenBank Submission: KX799197

> BO28944.complete
GAAGTTATCAGTCGACATGGCGCTAATAAATGCTTATCGAAGACGCATAA
AGCGAGTAAATTCGCAGCCATTAAACGGGCATAAAACTCGAAGCCGGGGC
CGAAGCGAAATTGTGGGGCCGACAAATCAAAGTACAAGCCTCAGGACCAA
CCTCATTCTCCTATTTCCCAGCCATGAAATAAAACCAGGCAACAATGAAA
CCCAAAGCGTCTCCCAAGCGATTTCAATGCGGGCATTCATCGGTCGAGCC
AAGGAATTGGCCACCCACAAGACCCAAAACCCAGAACCCAAACTTCCAGT
GAACCTTCCACCCTCGTCACCTCCAGCACCCCATTTAAAGGCCCTTCCTT
CGAGGCAACACTCGCTATATAACCATCTTACCCAACGTGCAAGCTTTCTA
GACCAT

BO28944.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-RA 375 CG42831-PA 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-RA 1266 CG42831-RA 250..622 16..388 1865 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10815068..10815440 16..388 1865 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:18:13 has no hits.

BO28944.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:10 Download gff for BO28944.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 251..622 17..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:57:25 Download gff for BO28944.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 251..622 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:59 Download gff for BO28944.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 251..622 17..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:59 Download gff for BO28944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10815069..10815440 17..390 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:57:25 Download gff for BO28944.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10808169..10808540 17..390 99   Plus

BO28944.pep Sequence

Translation from 16 to 406

> BO28944.pep
MALINAYRRRIKRVNSQPLNGHKTRSRGRSEIVGPTNQSTSLRTNLILLF
PSHEIKPGNNETQSVSQAISMRAFIGRAKELATHKTQNPEPKLPVNLPPS
SPPAPHLKALPSRQHSLYNHLTQRASFLDH

BO28944.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-PA 124 CG42831-PA 1..124 1..124 640 100 Plus