Clone BO28946 Report

Search the DGRC for BO28946

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG42703-RA
Protein status:BO28946.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO28946.complete Sequence

268 bp assembled on 2011-08-24

GenBank Submission: KX795014

> BO28946.complete
GAAGTTATCAGTCGACATGTCGAATATACTTGCTGCCAAACTCGACTGCC
AATGCGCCGGAAAAAACAGTCCCATGGATTCGGTGATAGTGCCGATTACC
CAGGAACTGAAGTGCATGCAAAAACTGGTCAAAAGGGTAAGACATTTTCA
AATGGCCAGGCTTTTCCAAAGCGAATCTGAGATGTACGCTGAAGAACTAA
AGGCCCGGAATCTTGCCATTTGGCGTGAACCTGATTATCGATACTGCAAG
GCAAGCTTTCTAGACCAT

BO28946.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-RA 237 CG42703-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-RA 488 CG42703-RA 86..319 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23101401..23101623 250..28 1115 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:16:35 has no hits.

BO28946.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:07 Download gff for BO28946.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 10..243 17..252 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:39 Download gff for BO28946.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 86..319 17..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:19 Download gff for BO28946.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 86..319 17..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:19 Download gff for BO28946.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23101397..23101630 20..252 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:39 Download gff for BO28946.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18988920..18989153 20..252 97   Minus

BO28946.pep Sequence

Translation from 16 to 268

> BO28946.pep
MSNILAAKLDCQCAGKNSPMDSVIVPITQELKCMQKLVKRVRHFQMARLF
QSESEMYAEELKARNLAIWREPDYRYCKASFLDH

BO28946.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-PA 78 CG42703-PA 1..78 1..78 409 100 Plus