Clone BO28947 Report

Search the DGRC for BO28947

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:47
Vector:pDNR-Dual
Associated Gene/Transcriptmex1-RB
Protein status:BO28947.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO28947.complete Sequence

283 bp assembled on 2011-08-24

GenBank Submission: KX800025

> BO28947.complete
GAAGTTATCAGTCGACATGTGCAACGCCATTTGTGAATGCCTTAAATGTC
CTGGCAAAGTTATTTGCTGCTGCTGTTCCTGCGCCTGCAAGATGCTCCTG
AGCATCGTGTTTTCTGCGCTCCTGATGGTCGTGGTGATCGGCTTGATTGT
CTACTTCACGGTCTTCTATCACAAGGATAAGAACACGGATGAGGTGCAGA
AGCAGGTCGCCCAACTGACGCCCATTGTGAAGCGCAGCATACGCGACTAC
TTCAACAAGGAGTACGCAAGCTTTCTAGACCAT

BO28947.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RB 252 CG7936-PB 1..249 17..265 1245 100 Plus
mex1-RC 252 CG7936-PC 1..249 17..265 1140 97.2 Plus
mex1-RA 252 CG7936-PA 1..249 17..265 1140 97.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RB 741 CG7936-RB 83..332 16..265 1250 100 Plus
mex1-RC 1034 CG7936-RC 425..674 16..265 1145 97.2 Plus
mex1-RA 710 CG7936-RA 101..350 16..265 1145 97.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517833..15518034 265..64 995 99.5 Minus
3L 28110227 3L 15519457..15519510 69..16 270 100 Minus
Blast to na_te.dros performed 2014-11-26 16:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 138..64 111 62.7 Minus

BO28947.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:08 Download gff for BO28947.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 84..332 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:45 Download gff for BO28947.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 84..332 17..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:26 Download gff for BO28947.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 84..332 17..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:26 Download gff for BO28947.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15517830..15518028 70..267 98 <- Minus
3L 15519457..15519509 17..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:45 Download gff for BO28947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510930..15511128 70..267 98 <- Minus
arm_3L 15512557..15512609 17..69 100   Minus

BO28947.pep Sequence

Translation from 16 to 283

> BO28947.pep
MCNAICECLKCPGKVICCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEYASFLDH

BO28947.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PB 83 CG7936-PB 1..83 1..83 450 100 Plus
mex1-PC 83 CG7936-PC 1..83 1..83 447 97.6 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 147 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 147 36.4 Plus