Clone BO28950 Report

Search the DGRC for BO28950

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG43104-RA
Protein status:BO28950.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO28950.complete Sequence

295 bp assembled on 2011-08-24

GenBank Submission: KX799409

> BO28950.complete
GAAGTTATCAGTCGACATGATCGATAACCAAGGACTTTTCATCTCACCAC
TGCAGTGTAGCTGCTTCGGCTGTAACAATTTGCGGAAATTAGCCAAGGTG
TTTTATGGTCATCACCATCGACTCACCCTCTGTCCACTATTACACTCATC
GGATAAAGGAGCCGTGGCACTGCGAAGTGGATTGTTGTCCGGCAACGTGG
AAATGTTTACTTTTTCTTCGGTTTGCTTTTCCAACACTCTGTACCGAACG
ATGAGCTGCCTTTGGGGGCTTTTTAATGCAAGCTTTCTAGACCAT

BO28950.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 16:18:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 16:18:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16737223..16737443 277..57 1105 100 Minus
2R 25286936 2R 16737717..16737759 57..15 215 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:18:31 has no hits.

BO28950.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:11 Download gff for BO28950.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 94..354 17..279 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:57:33 Download gff for BO28950.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 94..354 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:06 Download gff for BO28950.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737220..16737442 58..279 99 <- Minus
2R 16737717..16737757 17..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:06 Download gff for BO28950.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737220..16737442 58..279 99 <- Minus
2R 16737717..16737757 17..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:57:33 Download gff for BO28950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12624725..12624947 58..279 99 <- Minus
arm_2R 12625222..12625262 17..57 100   Minus

BO28950.pep Sequence

Translation from 16 to 295

> BO28950.pep
MIDNQGLFISPLQCSCFGCNNLRKLAKVFYGHHHRLTLCPLLHSSDKGAV
ALRSGLLSGNVEMFTFSSVCFSNTLYRTMSCLWGLFNASFLDH
Sequence BO28950.pep has no blast hits.