Clone BO28958 Report

Search the DGRC for BO28958

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG42656-RA
Protein status:BO28958.pep: Imported from assembly
Sequenced Size:188

Clone Sequence Records

BO28958.complete Sequence

188 bp assembled on 2011-08-24

> BO28958.complete
GAAGTTATCAGTCGACATGGATGCACTTCTGAAAATTGTCTTGTTGATCA
GCTTGTATTTCATTGCAATAAGCCTGCACTTGGGATTGTGTGACGATGTT
CCTTCCGCCGAGGCAGACACAGTGGTAACTGAAAGTGAAGAGCACTACAC
CGCATCCGATGACTTCGACTATGCAAGCTTTCTAGACC

BO28958.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-RA 159 CG42656-PA 1..156 17..172 780 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-RA 255 CG42656-RA 29..191 10..172 800 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7493025..7493149 172..48 625 100 Minus
3R 32079331 3R 7493202..7493243 51..10 195 97.6 Minus
Blast to na_te.dros performed on 2014-11-27 06:54:08 has no hits.

BO28958.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:50 Download gff for BO28958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 36..191 17..172 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:21 Download gff for BO28958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 36..191 17..172 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:35 Download gff for BO28958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 36..191 17..172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:35 Download gff for BO28958.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7493025..7493145 52..172 100 <- Minus
3R 7493202..7493236 17..51 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:21 Download gff for BO28958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3318747..3318867 52..172 100 <- Minus
arm_3R 3318924..3318958 17..51 100   Minus

BO28958.pep Sequence

Translation from 16 to 187

> BO28958.pep
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DYASFLD

BO28958.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-PA 52 CG42656-PA 1..52 1..52 262 100 Plus