BO28958.complete Sequence
188 bp assembled on 2011-08-24
> BO28958.complete
GAAGTTATCAGTCGACATGGATGCACTTCTGAAAATTGTCTTGTTGATCA
GCTTGTATTTCATTGCAATAAGCCTGCACTTGGGATTGTGTGACGATGTT
CCTTCCGCCGAGGCAGACACAGTGGTAACTGAAAGTGAAGAGCACTACAC
CGCATCCGATGACTTCGACTATGCAAGCTTTCTAGACC
BO28958.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:54:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-RA | 159 | CG42656-PA | 1..156 | 17..172 | 780 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:54:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-RA | 255 | CG42656-RA | 29..191 | 10..172 | 800 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:54:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7493025..7493149 | 172..48 | 625 | 100 | Minus |
3R | 32079331 | 3R | 7493202..7493243 | 51..10 | 195 | 97.6 | Minus |
Blast to na_te.dros performed on 2014-11-27 06:54:08 has no hits.
BO28958.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:50 Download gff for
BO28958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 36..191 | 17..172 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:21 Download gff for
BO28958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 36..191 | 17..172 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:35 Download gff for
BO28958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 36..191 | 17..172 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:35 Download gff for
BO28958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7493025..7493145 | 52..172 | 100 | <- | Minus |
3R | 7493202..7493236 | 17..51 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:21 Download gff for
BO28958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 3318747..3318867 | 52..172 | 100 | <- | Minus |
arm_3R | 3318924..3318958 | 17..51 | 100 | | Minus |
BO28958.pep Sequence
Translation from 16 to 187
> BO28958.pep
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DYASFLD
BO28958.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-PA | 52 | CG42656-PA | 1..52 | 1..52 | 262 | 100 | Plus |