Clone BO28974 Report

Search the DGRC for BO28974

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG43063-RA
Protein status:BO28974.pep: Imported from assembly
Sequenced Size:442

Clone Sequence Records

BO28974.complete Sequence

442 bp assembled on 2011-08-24

GenBank Submission: KX795516

> BO28974.complete
GAAGTTATCAGTCGACATGGAAATGCACTTCTCAGTATTTGTTGCGGTCA
CATTTCTTTTGCTGTCGGACATCACTCATCCGCTGGAGACCCTCGATGAC
TTTGAAGTCGCCGAGGAAATAACTACACCGCGCGAAAATGGGGATATTGT
TGGTCCTCTTAATCCGAAACGCATCGAGGGACGAACTCGACAAATGAGCG
TACTATCTTTTGTGGGAAAAAACCGAACGGGCAAAATGAATGAAAACTAT
TGCTGCTTCTGGATATATCAGGCCCATCCTCCCATTCCTCACAGCTGGAA
ACATATGGCCGAGTATCCATTCGATTTTCAGTTCAACGGAGAGTTTGTGC
GGAACCAACGACACAATGAAGTTGAAGTGCCTGCAGTTCAGGATGGCGAC
AGTGACAACTCAACAAGTGTAATTGCAAGCTTTCTAGACCAT

BO28974.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG43063-RA 405 CG43063-PA 1..402 23..424 2010 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43063-RA 488 CG43063-RA 29..436 17..424 2040 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13086326..13086709 41..424 1920 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:23:30 has no hits.

BO28974.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:19 Download gff for BO28974.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 29..436 17..426 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:49 Download gff for BO28974.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 29..436 17..426 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:57 Download gff for BO28974.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 29..436 17..426 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:57 Download gff for BO28974.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13086252..13086276 17..41 100 -> Plus
3R 13086327..13086709 42..426 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:49 Download gff for BO28974.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8911974..8911998 17..41 100 -> Plus
arm_3R 8912049..8912431 42..426 99   Plus

BO28974.pep Sequence

Translation from 16 to 442

> BO28974.pep
MEMHFSVFVAVTFLLLSDITHPLETLDDFEVAEEITTPRENGDIVGPLNP
KRIEGRTRQMSVLSFVGKNRTGKMNENYCCFWIYQAHPPIPHSWKHMAEY
PFDFQFNGEFVRNQRHNEVEVPAVQDGDSDNSTSVIASFLDH

BO28974.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43063-PA 134 CG43063-PA 1..134 3..136 727 100 Plus