BO28978.complete Sequence
151 bp assembled on 2011-08-24
GenBank Submission: KX799649
> BO28978.complete
GAAGTTATCAGTCGACATGTCCCCTGGCCACTTAATCCTGCTGCAGTTCA
GCATGCACTGTTTCAAGATCATTTTCATCTATTGCATCTGTGTTAATGTC
CTGGAGCATCTTGTTCAAAGCGTCCAGGAACACGCAAGCTTTCTAGACCA
T
BO28978.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-RA | 120 | CG42781-PA | 1..117 | 17..133 | 585 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-RA | 258 | CG42781-RA | 83..200 | 16..133 | 590 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7382791..7382908 | 133..16 | 590 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:24:46 has no hits.
BO28978.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:20 Download gff for
BO28978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..117 | 17..135 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:20 Download gff for
BO28978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 50..166 | 17..135 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:18:27 Download gff for
BO28978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 84..200 | 17..135 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:18:27 Download gff for
BO28978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7382788..7382907 | 17..135 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:20 Download gff for
BO28978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7276821..7276940 | 17..135 | 98 | | Minus |
BO28978.pep Sequence
Translation from 16 to 151
> BO28978.pep
MSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQSVQEHASFLDH
BO28978.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-PA | 39 | CG42781-PA | 1..39 | 1..39 | 211 | 100 | Plus |