Clone BO28978 Report

Search the DGRC for BO28978

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG42781-RA
Protein status:BO28978.pep: Imported from assembly
Sequenced Size:151

Clone Sequence Records

BO28978.complete Sequence

151 bp assembled on 2011-08-24

GenBank Submission: KX799649

> BO28978.complete
GAAGTTATCAGTCGACATGTCCCCTGGCCACTTAATCCTGCTGCAGTTCA
GCATGCACTGTTTCAAGATCATTTTCATCTATTGCATCTGTGTTAATGTC
CTGGAGCATCTTGTTCAAAGCGTCCAGGAACACGCAAGCTTTCTAGACCA
T

BO28978.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-RA 120 CG42781-PA 1..117 17..133 585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-RA 258 CG42781-RA 83..200 16..133 590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7382791..7382908 133..16 590 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:24:46 has no hits.

BO28978.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:20 Download gff for BO28978.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..117 17..135 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:20 Download gff for BO28978.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 50..166 17..135 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:18:27 Download gff for BO28978.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 84..200 17..135 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:18:27 Download gff for BO28978.complete
Subject Subject Range Query Range Percent Splice Strand
X 7382788..7382907 17..135 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:20 Download gff for BO28978.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7276821..7276940 17..135 98   Minus

BO28978.pep Sequence

Translation from 16 to 151

> BO28978.pep
MSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQSVQEHASFLDH

BO28978.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-PA 39 CG42781-PA 1..39 1..39 211 100 Plus