BO28982.complete Sequence
196 bp assembled on 2011-08-24
> BO28982.complete
GAAGTTATCAGTCGACATGCGGTTGATTTTTTTCTGCTTGTGCCTCTTTT
TGTCCCTGGAGCTAGTAGTGCCCAGACATGTCGTGGGCCACGATGGATAC
CACAACATCGAGAAGGAAAAGCGCTGGAAAAACTGGCCAGCACGTGTGAG
GCACCACCATAAACAACGTAACTCCATCGCAAGCTTTATAGACCAT
BO28982.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:22:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42866-RA | 165 | CG42866-PA | 1..162 | 17..178 | 810 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:22:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42866-RA | 403 | CG42866-RA | 24..185 | 17..178 | 810 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:22:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19961442..19961580 | 178..40 | 695 | 100 | Minus |
Blast to na_te.dros performed 2014-11-26 16:22:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 3002..3041 | 124..165 | 115 | 78.6 | Plus |
BO28982.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:16 Download gff for
BO28982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42866-RA | 1..162 | 17..180 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:06 Download gff for
BO28982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42866-RA | 24..185 | 17..180 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:23 Download gff for
BO28982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42866-RA | 24..185 | 17..180 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:23 Download gff for
BO28982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19961439..19961579 | 41..180 | 98 | <- | Minus |
2L | 19961639..19961662 | 17..40 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:06 Download gff for
BO28982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19961439..19961579 | 41..180 | 98 | <- | Minus |
arm_2L | 19961639..19961662 | 17..40 | 100 | | Minus |
BO28982.pep Sequence
Translation from 16 to 196
> BO28982.pep
MRLIFFCLCLFLSLELVVPRHVVGHDGYHNIEKEKRWKNWPARVRHHHKQ
RNSIASFIDH
BO28982.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42866-PA | 54 | CG42866-PA | 1..54 | 1..54 | 306 | 100 | Plus |