Clone BO28982 Report

Search the DGRC for BO28982

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG42866-RA
Protein status:BO28982.pep: Imported from assembly
Sequenced Size:196

Clone Sequence Records

BO28982.complete Sequence

196 bp assembled on 2011-08-24

> BO28982.complete
GAAGTTATCAGTCGACATGCGGTTGATTTTTTTCTGCTTGTGCCTCTTTT
TGTCCCTGGAGCTAGTAGTGCCCAGACATGTCGTGGGCCACGATGGATAC
CACAACATCGAGAAGGAAAAGCGCTGGAAAAACTGGCCAGCACGTGTGAG
GCACCACCATAAACAACGTAACTCCATCGCAAGCTTTATAGACCAT

BO28982.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-RA 165 CG42866-PA 1..162 17..178 810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-RA 403 CG42866-RA 24..185 17..178 810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19961442..19961580 178..40 695 100 Minus
Blast to na_te.dros performed 2014-11-26 16:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 3002..3041 124..165 115 78.6 Plus

BO28982.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:16 Download gff for BO28982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..162 17..180 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:06 Download gff for BO28982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 24..185 17..180 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:23 Download gff for BO28982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 24..185 17..180 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:23 Download gff for BO28982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961439..19961579 41..180 98 <- Minus
2L 19961639..19961662 17..40 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:06 Download gff for BO28982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19961439..19961579 41..180 98 <- Minus
arm_2L 19961639..19961662 17..40 100   Minus

BO28982.pep Sequence

Translation from 16 to 196

> BO28982.pep
MRLIFFCLCLFLSLELVVPRHVVGHDGYHNIEKEKRWKNWPARVRHHHKQ
RNSIASFIDH

BO28982.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-PA 54 CG42866-PA 1..54 1..54 306 100 Plus