Clone BO28983 Report

Search the DGRC for BO28983

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG43101-RA
Protein status:BO28983.pep: Imported from assembly
Sequenced Size:361

Clone Sequence Records

BO28983.complete Sequence

361 bp assembled on 2011-08-24

GenBank Submission: KX796984

> BO28983.complete
GAAGTTATCAGTCGACATGATCAAGTTTTTTGCCGTGGTTGTCTTGCTGG
CCATAAGTCCGCTATCGTCTGATTCTACTCTAATTGACATTGTGTCTAGT
TGTATAAATTTTCAGTTTAAGGCATTACTATACCTTGCGGAATCAACTGA
TGATAAATTTCATTGTATTGAAACATGTGTATATGATATTATCAGAAATC
TTACAAAGATTGATCTACCTAAACGCCCGGATCCCGAAATATGTCAAGGC
TTAAATGACAAATGTAAGTACGCCGAAGGATTACGAAAGTGTCTTCCACC
AAATTTAGATGAAAGATTTTGGAAAGATGTTTTTACACGAATAGCAAGCT
TTCTAGACCAT

BO28983.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG43101-RA 330 CG43101-PA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG43101-RA 405 CG43101-RA 24..350 17..343 1635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15013102..15013362 343..83 1305 100 Minus
2R 25286936 2R 15013434..15013499 82..17 330 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:22:24 has no hits.

BO28983.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:17 Download gff for BO28983.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 1..327 17..345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:12 Download gff for BO28983.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 24..350 17..345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:29 Download gff for BO28983.complete
Subject Subject Range Query Range Percent Splice Strand
CG43101-RA 24..350 17..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:29 Download gff for BO28983.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15013100..15013362 83..345 99 <- Minus
2R 15013434..15013499 17..82 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:12 Download gff for BO28983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10900605..10900867 83..345 99 <- Minus
arm_2R 10900939..10901004 17..82 100   Minus

BO28983.pep Sequence

Translation from 16 to 361

> BO28983.pep
MIKFFAVVVLLAISPLSSDSTLIDIVSSCINFQFKALLYLAESTDDKFHC
IETCVYDIIRNLTKIDLPKRPDPEICQGLNDKCKYAEGLRKCLPPNLDER
FWKDVFTRIASFLDH

BO28983.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG43101-PA 109 CG43101-PA 1..109 1..109 577 100 Plus