Clone BO28984 Report

Search the DGRC for BO28984

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG42870-RA
Protein status:BO28984.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO28984.complete Sequence

280 bp assembled on 2011-08-24

GenBank Submission: KX797850

> BO28984.complete
GAAGTTATCAGTCGACATGCTTTTGGGCATGGCCATCGCTTTTCCCACTC
ATCAGTTCGTGCCACACATACCTTATGGCATGGATGACTTTTACCCGTTT
CTTGCCAGAAATTCCACCGATGTGCTGCCGTTGTCTACAAATCTAACTCA
AATTGAACGACTAGGATGGGCCGATAAATGTGTGCAGTTTAGAAATAAGT
GCACATTAGCAGAGCATTGTTGCAGTCTTAGATGCCTGAAACGTATTTAT
CGATGCATTACCGCAAGCTTTCTAGACCAT

BO28984.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-RB 285 CG42870-PB 37..282 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-RB 368 CG42870-RB 45..290 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21737186..21737320 151..17 675 100 Minus
3R 32079331 3R 21737011..21737121 262..152 555 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:22:42 has no hits.

BO28984.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:17 Download gff for BO28984.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RA 11..256 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:22 Download gff for BO28984.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 45..290 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:36 Download gff for BO28984.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 45..290 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:36 Download gff for BO28984.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21737009..21737121 152..264 98 <- Minus
3R 21737186..21737320 17..151 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:22 Download gff for BO28984.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17562731..17562843 152..264 98 <- Minus
arm_3R 17562908..17563042 17..151 100   Minus

BO28984.pep Sequence

Translation from 16 to 280

> BO28984.pep
MLLGMAIAFPTHQFVPHIPYGMDDFYPFLARNSTDVLPLSTNLTQIERLG
WADKCVQFRNKCTLAEHCCSLRCLKRIYRCITASFLDH

BO28984.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-PB 94 CG42870-PB 13..94 1..82 454 100 Plus