Clone BO28986 Report

Search the DGRC for BO28986

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG42737-RA
Protein status:BO28986.pep: Imported from assembly
Sequenced Size:234

Clone Sequence Records

BO28986.complete Sequence

234 bp assembled on 2011-08-24

> BO28986.complete
GAAGTTATCAGTCGACATGAAAAGATGCAGCCGTATAAATCGCACTGGAA
TTGAGCGATCGCAGTTATTGACTCGTCTCAATTGTCGCAGCGATGAAGTG
GTTTTCGATTTTGTTTGCGCTACTGGCGCTCATTTTCTTCGTCGAATTTG
GATATGCTCGAACAATTCCCAGGATTACCATTCGCAATGGCGACATTATA
GTTCATGGCAATTGCAAGCAAGCTTTCATAGACC

BO28986.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43202-RA 192 CG43202-PA 1..125 93..217 625 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG43202-RA 390 CG43202-RA 1..206 12..217 1015 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18381696..18381845 160..11 735 99.3 Minus
2R 25286936 2R 18381577..18381634 217..160 290 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:26:46 has no hits.

BO28986.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:24 Download gff for BO28986.complete
Subject Subject Range Query Range Percent Splice Strand
CG42737-RA 6..206 17..218 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:01:08 Download gff for BO28986.complete
Subject Subject Range Query Range Percent Splice Strand
CG43202-RA 6..206 17..218 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:19 Download gff for BO28986.complete
Subject Subject Range Query Range Percent Splice Strand
CG43202-RA 6..206 17..218 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:19:19 Download gff for BO28986.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18381575..18381634 160..218 98 <- Minus
2R 18381697..18381839 17..159 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:08 Download gff for BO28986.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14269080..14269139 160..218 98 <- Minus
arm_2R 14269202..14269344 17..159 100   Minus

BO28986.pep Sequence

Translation from 16 to 232

> BO28986.pep
MKRCSRINRTGIERSQLLTRLNCRSDEVVFDFVCATGAHFLRRIWICSNN
SQDYHSQWRHYSSWQLQASFHR
Sequence BO28986.pep has no blast hits.