Clone BO28993 Report

Search the DGRC for BO28993

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG43061-RA
Protein status:BO28993.pep: Imported from assembly
Sequenced Size:191

Clone Sequence Records

BO28993.complete Sequence

191 bp assembled on 2011-08-24

> BO28993.complete
GAAGTTATCAGTCGACATGTTGATTGCCCGACTTGGATTCTTGTTGTGCT
CATTGGGCCTTGCAACTGCCATATGTCAAACGAATGGGGAAAGTTGTAAG
TCGCATGCGGATTGCTGCTCCACGATGTGCCTGACCCAACTGGGTCAGTG
TTCACCCAAAAGGGGAGATCAGTGGGCAAGCTTTCTAGACC

BO28993.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-RA 162 CG43061-PA 1..159 17..175 795 100 Plus
Sfp93F-RA 162 CG42608-PA 1..159 17..175 765 98.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-RA 329 CG43061-RA 30..188 17..175 795 100 Plus
Sfp93F-RA 329 CG42608-RA 30..188 17..175 765 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8049838..8049918 95..175 405 100 Plus
3R 32079331 3R 21736050..21736130 175..95 405 100 Minus
3R 32079331 3R 8049702..8049779 17..94 390 100 Plus
3R 32079331 3R 21736190..21736267 94..17 360 97.4 Minus
Blast to na_te.dros performed on 2014-11-26 16:28:35 has no hits.

BO28993.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:28 Download gff for BO28993.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 35..188 22..175 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:01:51 Download gff for BO28993.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 35..188 22..175 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:02 Download gff for BO28993.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 35..188 22..175 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:02 Download gff for BO28993.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21736050..21736130 95..175 100 <- Minus
3R 21736190..21736262 22..94 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:51 Download gff for BO28993.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17561772..17561852 95..175 100 <- Minus
arm_3R 17561912..17561984 22..94 97   Minus

BO28993.pep Sequence

Translation from 16 to 190

> BO28993.pep
MLIARLGFLLCSLGLATAICQTNGESCKSHADCCSTMCLTQLGQCSPKRG
DQWASFLD

BO28993.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-PA 53 CG43061-PA 1..53 1..53 294 100 Plus
Sfp93F-PA 53 CG42608-PA 1..53 1..53 285 96.2 Plus