Clone BO28995 Report

Search the DGRC for BO28995

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG34248-RB
Protein status:BO28995.pep: Imported from assembly
Sequenced Size:310

Clone Sequence Records

BO28995.complete Sequence

310 bp assembled on 2011-09-14

GenBank Submission: KX798150

> BO28995.complete
GAAGTTATCAGTCGACATGTACAGGAAATTAGTGGTGCTCCTCCTTCTGA
TCCACCTGGCGGCCGCGGGTCAGATCCAGGATGCTGCCGAGGAGATCGAT
GTGCCGCCTGCCCATCGGGCTGCTCCACCACCGCCCCGCCAGGCAGCTGG
AGCTGCTGTTCCCCCACCACCACTGGGGCCACCACCACTTGTGGGCTCTG
CACCGCCGCCGAGCTATCCTTTGTTCTACCCAGCTGCGTGGCTGCCATTC
GGACGCTACAGCAACTCCATTCCCGTCCACATAGTGGCTGCCGCAAGCTT
TCTAGACCAT

BO28995.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-RB 279 CG34248-PB 1..276 17..292 1380 100 Plus
CG34248-RA 297 CG34248-PA 34..294 32..292 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-RB 452 CG34248-RB 41..316 17..292 1380 100 Plus
CG34248-RA 533 CG34248-RA 138..398 32..292 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16270505..16270765 292..32 1305 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:22:44 has no hits.

BO28995.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:00:00 Download gff for BO28995.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 41..316 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:30 Download gff for BO28995.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 41..316 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:26 Download gff for BO28995.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 41..316 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:26 Download gff for BO28995.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16270503..16270765 32..294 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:30 Download gff for BO28995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16263603..16263865 32..294 99 <- Minus

BO28995.pep Sequence

Translation from 16 to 310

> BO28995.pep
MYRKLVVLLLLIHLAAAGQIQDAAEEIDVPPAHRAAPPPPRQAAGAAVPP
PPLGPPPLVGSAPPPSYPLFYPAAWLPFGRYSNSIPVHIVAAASFLDH

BO28995.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-PB 92 CG34248-PB 1..92 1..92 490 100 Plus
CG34248-PA 98 CG34248-PA 12..98 6..92 464 100 Plus