BO28995.complete Sequence
310 bp assembled on 2011-09-14
GenBank Submission: KX798150
> BO28995.complete
GAAGTTATCAGTCGACATGTACAGGAAATTAGTGGTGCTCCTCCTTCTGA
TCCACCTGGCGGCCGCGGGTCAGATCCAGGATGCTGCCGAGGAGATCGAT
GTGCCGCCTGCCCATCGGGCTGCTCCACCACCGCCCCGCCAGGCAGCTGG
AGCTGCTGTTCCCCCACCACCACTGGGGCCACCACCACTTGTGGGCTCTG
CACCGCCGCCGAGCTATCCTTTGTTCTACCCAGCTGCGTGGCTGCCATTC
GGACGCTACAGCAACTCCATTCCCGTCCACATAGTGGCTGCCGCAAGCTT
TCTAGACCAT
BO28995.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:22:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34248-RB | 279 | CG34248-PB | 1..276 | 17..292 | 1380 | 100 | Plus |
CG34248-RA | 297 | CG34248-PA | 34..294 | 32..292 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:22:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34248-RB | 452 | CG34248-RB | 41..316 | 17..292 | 1380 | 100 | Plus |
CG34248-RA | 533 | CG34248-RA | 138..398 | 32..292 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:22:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16270505..16270765 | 292..32 | 1305 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:22:44 has no hits.
BO28995.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:00:00 Download gff for
BO28995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34248-RB | 41..316 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:30 Download gff for
BO28995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34248-RB | 41..316 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:26 Download gff for
BO28995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34248-RB | 41..316 | 17..294 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:26 Download gff for
BO28995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16270503..16270765 | 32..294 | 99 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:30 Download gff for
BO28995.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16263603..16263865 | 32..294 | 99 | <- | Minus |
BO28995.pep Sequence
Translation from 16 to 310
> BO28995.pep
MYRKLVVLLLLIHLAAAGQIQDAAEEIDVPPAHRAAPPPPRQAAGAAVPP
PPLGPPPLVGSAPPPSYPLFYPAAWLPFGRYSNSIPVHIVAAASFLDH
BO28995.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34248-PB | 92 | CG34248-PB | 1..92 | 1..92 | 490 | 100 | Plus |
CG34248-PA | 98 | CG34248-PA | 12..98 | 6..92 | 464 | 100 | Plus |